• Gene id: 25800

Gene Summary

• Gene Symbol: SLC39A6   Gene   UCSC   Ensembl
• Aliases: LIV-1, ZIP6
• Gene name: solute carrier family 39 member 6
• Alternate names: zinc transporter ZIP6, LIV-1 protein, estrogen regulated, ZIP-6, estrogen-regulated protein LIV-1, solute carrier family 39 (metal ion transporter), member 6, solute carrier family 39 (zinc transporter), member 6, zrt- and Irt-like protein 6,
• Gene location: 18q12.2 (36129867: 36108530)     Exons: 11     NC_000018.10
• Gene summary(Entrez): Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily o
• OMIM: 608731

Protein Summary

• Protein general information: Q13433  
  • Name: Zinc transporter ZIP6 (Estrogen regulated protein LIV 1) (Solute carrier family 39 member 6) (Zrt and Irt like protein 6) (ZIP 6)
  • Length: 755  
  • Mass: 85047
  • Tissue specificity: Highly expressed in the breast, prostate, placenta, kidney, pituitary and corpus callosum. Weakly expressed in heart and intestine. Also highly expressed in cells derived from an adenocarcinoma of the cervix and lung carcinoma. {ECO
• Sequence:

  MARKLSVILILTFALSVTNPLHELKAAAFPQTTEKISPNWESGINVDLAISTRQYHLQQLFYRYGENNSLSVEGF
  RKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHERHSDHEHHSEHEHHSDHDHHSHHNHAASGKNKRKALCPDHD
  SDSSGKDPRNSQGKGAHRPEHASGRRNVKDSVSASEVTSTVYNTVSEGTHFLETIETPRPGKLFPKDVSSSTPPS
  VTSKSRVSRLAGRKTNESVSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDA
  RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDAFL
  HLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDK
  KKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQ
  EVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGVATLAWMVI
  MGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATG
  IFIGHYAENVSMWIFALTAGLFMYVALVDMVPEMLHNDASDHGCSRWGYFFLQNAGMLLGFGIMLLISIFEHKIV
  FRINF

• Structural information:
  • Interpro: IPR003689  
  • STRING: ENSP00000269187
• Other Databases: GeneCards:  SLC39A6  Malacards:  SLC39A6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0071578	zinc ion import across plasma membrane	IBA	biological process
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0006829	zinc ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005385	zinc ion transmembrane transporter activity	IDA	molecular function
GO:0006882	cellular zinc ion homeostasis	IDA	biological process
GO:0071578	zinc ion import across plasma membrane	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031258	lamellipodium membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0071577	zinc ion transmembrane transport	IMP	biological process
GO:0009986	cell surface	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)