• Gene id: 25793

Gene Summary

• Gene Symbol: FBXO7   Gene   UCSC   Ensembl
• Aliases: FBX, FBX07, FBX7, PARK15, PKPS
• Gene name: F-box protein 7
• Alternate names: F-box only protein 7,
• Gene location: 22q12.3 (32474681: 32498830)     Exons: 10     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box

Protein Summary

• Protein general information: Q9Y3I1  
  • Name: F box only protein 7
  • Length: 522  
  • Mass: 58503
• Sequence:

  MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLIC
  LILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAES
  IQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMP
  EKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKD
  LQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFL
  YLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQ
  RPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM

• Structural information:
  • Protein Domains: (329..37-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  IPR021625  IPR029071  
  • Prosite: PS50181
  • PDB: 4L9C 4L9H
  • PDBsum: 4L9C 4L9H
  • DIP: 36125
  • STRING: ENSP00000266087
• Other Databases: GeneCards:  FBXO7  Malacards:  FBXO7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:1990038	Lewy body corona	IDA	cellular component
GO:0097409	glial cytoplasmic inclusion	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:1903204	negative regulation of oxidative stress-induced neuron death	IMP	biological process
GO:1903599	positive regulation of autophagy of mitochondrion	IDA	biological process
GO:0043130	ubiquitin binding	IDA	molecular function
GO:1990037	Lewy body core	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0010975	regulation of neuron projection development	IMP	biological process
GO:0097414	classical Lewy body	IDA	cellular component
GO:0097462	Lewy neurite	IDA	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0040012	regulation of locomotion	IDA	biological process
GO:0019005	SCF ubiquitin ligase complex	TAS	cellular component
GO:1903599	positive regulation of autophagy of mitochondrion	IBA	biological process
GO:1903204	negative regulation of oxidative stress-induced neuron death	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006626	protein targeting to mitochondrion	IMP	biological process
GO:0016567	protein ubiquitination	IMP	biological process
GO:0000422	autophagy of mitochondrion	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0000151	ubiquitin ligase complex	TAS	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:1903599	positive regulation of autophagy of mitochondrion	IEA	biological process
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0045620	negative regulation of lymphocyte differentiation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0031647	regulation of protein stability	IDA	biological process
GO:1990756	ubiquitin ligase-substrate adaptor activity	IDA	molecular function
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Parkinson disease	KEGG:H00057
Parkinson disease	KEGG:H00057
Parkinson's disease	PMID:26223426
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881