• Gene id: 25789

Gene Summary

• Gene Symbol: TMEM59L   Gene   UCSC   Ensembl
• Aliases: BSMAP, C19orf4
• Gene name: transmembrane protein 59 like
• Alternate names: transmembrane protein 59-like, brain-specific membrane-anchored protein,
• Gene location: 19p13.11 (18612869: 18621039)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene encodes a predicted type-I membrane glycoprotein. The encoded protein may play a role in functioning of the central nervous system. [provided by RefSeq, Jul 2008]
• OMIM: 610089

Protein Summary

• Protein general information: Q9UK28  
  • Name: Transmembrane protein 59 like (Brain specific membrane anchored protein)
  • Length: 342  
  • Mass: 37619
  • Tissue specificity: Expressed preferentially at high level in the brain.
• Sequence:

  MAAVALMPPPLLLLLLLASPPAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDRAVLIS
  ACERGCRLFSICRFVARSSKPNATQTECEAACVEAYVKEAEQQACSHGCWSQPAEPEPEQKRKVLEAPSGALSLL
  DLFSTLCNDLVNSAQGFVSSTWTYYLQTDNGKVVVFQTQPIVESLGFQGGRLQRVEVTWRGSHPEALEVHVDPVG
  PLDKVRKAKIRVKTSSKAKVESEEPQDNDFLSCMSRRSGLPRWILACCLFLSVLVMLWLSCSTLVTAPGQHLKFQ
  PLTLEQHKGFMMEPDWPLYPPPSHACEDSLPPYKLKLDLTKL

• Structural information:
  • Interpro: IPR022065  
  • STRING: ENSP00000470879
• Other Databases: GeneCards:  TMEM59L  Malacards:  TMEM59L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881