• Gene id: 2578

Gene Summary

• Gene Symbol: GAGE6   Gene   UCSC   Ensembl
• Aliases: CT4.6
• Gene name: G antigen 6
• Alternate names: G antigen 6, GAGE-6, cancer/testis antigen 4.6, cancer/testis antigen family 4, member 6,
• Gene location: Xp11.4-p11.2 (103367975: 103389064)     Exons: 11     NC_000010.11
• Gene summary(Entrez): This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic pepti
• OMIM: 300599

Protein Summary

• Protein general information: Q13070  
  • Name: G antigen 6 (GAGE 6) (Cancer/testis antigen 4.6) (CT4.6)
  • Length: 117  
  • Mass: 12892
  • Tissue specificity: Expressed in a variety of tumor tissues but not in normal tissues, except testis.
• Sequence:

  MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAD
  SQEQGHPQTGCECEDGPDGQEVDPPNPEEVKTPEEGEKQSQC

• Structural information:
  • Interpro: IPR031320  IPR008625  
• Other Databases: GeneCards:  GAGE6  Malacards:  GAGE6

Gene ontology

GO accession	Term name	Evidence code	Go category

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)