• Gene id: 25777

Gene Summary

• Gene Symbol: SUN2   Gene   UCSC   Ensembl
• Aliases: UNC84B
• Gene name: Sad1 and UNC84 domain containing 2
• Alternate names: SUN domain-containing protein 2, Sad1 unc-84 domain protein 2, nuclear envelope protein, protein unc-84 homolog B, rab5-interacting protein, rab5IP, sad1/unc-84 protein-like 2, unc-84 homolog B,
• Gene location: 22q13.1 (38756013: 38734726)     Exons: 22     NC_000022.11
• Gene summary(Entrez): SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' across the nuclear envelope, known as the LINC complex, via interaction with the conserved luminal KAS

Protein Summary

• Protein general information: Q9UH99  
  • Name: SUN domain containing protein 2 (Protein unc 84 homolog B) (Rab5 interacting protein) (Rab5IP) (Sad1/unc 84 protein like 2)
  • Length: 717  
  • Mass: 80311
  • Tissue specificity: Widely expressed. Highly expressed in heart, lung and muscle. Weakly expressed in fetal heart. Slightly overexpressed in some heart tissues form patients with congenital heart defects. {ECO
• Sequence:

  MSRRSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNMKRLSPAPQLGPSSDAHTSYYSESLV
  HESWFPPRSSLEELHGDANWGEDLRVRRRRGTGGSESSRASGLVGRKATEDFLGSSSGYSSEDDYVGYSDVDQQS
  SSSRLRSAVSRAGSLLWMVATSPGRLFRLLYWWAGTTWYRLTTAASLLDVFVLTRRFSSLKTFLWFLLPLLLLTC
  LTYGAWYFYPYGLQTFHPALVSWWAAKDSRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQK
  EAMRLERLELRQGAPGQGGGGGLSHEDTLALLEGLVSRREAALKEDFRRETAARIQEELSALRAEHQQDSEDLFK
  KIVRASQESEARIQQLKSEWQSMTQESFQESSVKELRRLEDQLAGLQQELAALALKQSSVAEEVGLLPQQIQAVR
  DDVESQFPAWISQFLARGGGGRVGLLQREEMQAQLRELESKILTHVAEMQGKSAREAAASLSLTLQKEGVIGVTE
  EQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGN
  CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQ
  TFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGEPAH

• Structural information:
  • Protein Domains: (555..71-)
    (/note="SUN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00802"-)
  • Interpro: IPR008979  IPR030272  IPR040994  IPR012919  
  • Prosite: PS51469
  • PDB: 3UNP 4DXR 4DXS 4DXT 4FI9
  • PDBsum: 3UNP 4DXR 4DXS 4DXT 4FI9
  • STRING: ENSP00000385616
• Other Databases: GeneCards:  SUN2  Malacards:  SUN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006998	nuclear envelope organization	IBA	biological process
GO:0034993	meiotic nuclear membrane microtubule tethering complex	IBA	cellular component
GO:0043495	protein-membrane adaptor activity	IBA	molecular function
GO:0005635	nuclear envelope	IBA	cellular component
GO:0034993	meiotic nuclear membrane microtubule tethering complex	IDA	cellular component
GO:0005521	lamin binding	IDA	molecular function
GO:0090292	nuclear matrix anchoring at nuclear membrane	IDA	biological process
GO:0005635	nuclear envelope	IDA	cellular component
GO:0030335	positive regulation of cell migration	ISS	biological process
GO:0051642	centrosome localization	ISS	biological process
GO:0031022	nuclear migration along microfilament	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034993	meiotic nuclear membrane microtubule tethering complex	IEA	cellular component
GO:0005639	integral component of nuclear inner membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0006998	nuclear envelope organization	IGI	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0000794	condensed nuclear chromosome	IEA	cellular component
GO:0051642	centrosome localization	IEA	biological process
GO:0031022	nuclear migration along microfilament	IEA	biological process
GO:0021817	nucleokinesis involved in cell motility in cerebral cortex radial glia guided migration	IEA	biological process
GO:0005635	nuclear envelope	IEA	cellular component
GO:0000784	nuclear chromosome, telomeric region	IEA	cellular component
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0140444	cytoskeleton-nuclear membrane anchor activity	IDA	molecular function
GO:0005635	nuclear envelope	IDA	colocalizes with
GO:0005635	nuclear envelope	TAS	cellular component
GO:0008017	microtubule binding	TAS	molecular function
GO:0007097	nuclear migration	TAS	biological process
GO:0007052	mitotic spindle organization	TAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq