• Gene id: 25764

Gene Summary

• Gene Symbol: HYPK   Gene   UCSC   Ensembl
• Aliases: C15orf63, HSPC136
• Gene name: huntingtin interacting protein K
• Alternate names: huntingtin-interacting protein K, huntingtin yeast partner K,
• Gene location: 15q15.3 (43800420: 43804426)     Exons: 4     NC_000015.10
• OMIM: 612784

Protein Summary

• Protein general information: Q9NX55  
  • Name: Huntingtin interacting protein K (Huntingtin yeast partner K)
  • Length: 129  
  • Mass: 14665
• Sequence:

  MRRRGEIDMATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDRRSREQ
  KAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALTN

• Structural information:
  • Interpro: IPR038922  
  • CDD: cd14361
  • PDB: 6C95
  • PDBsum: 6C95
  • STRING: ENSP00000384474
• Other Databases: GeneCards:  HYPK  Malacards:  HYPK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0050821	protein stabilization	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0050821	protein stabilization	IDA	biological process
GO:0047485	protein N-terminus binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881