• Gene id: 257364

Gene Summary

• Gene Symbol: SNX33   Gene   UCSC   Ensembl
• Aliases: SH3PX3, SH3PXD3C, SNX30
• Gene name: sorting nexin 33
• Alternate names: sorting nexin-33, SH3 and PX domain containing 3, SH3 and PX domain-containing protein 3,
• Gene location: 15q24.2 (75647911: 75662300)     Exons: 2     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is involved in cytoskeletal reorganization, vesicle trafficking, endocytosis, and mitosis. The encoded protein is essential for the creation of the cleavage furrow during mitosis and for completion of mitosis. Two transcri

Protein Summary

• Protein general information: Q8WV41  
  • Name: Sorting nexin 33 (SH3 and PX domain containing protein 3)
  • Length: 574  
  • Mass: 65265
  • Tissue specificity: Detected in heart and pancreas. {ECO
• Sequence:

  MALKGRALYDFHSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIVRSGISTNHADYSSSPA
  GSPGAQVSLYNSPSVASPARSGGGSGFLSNQGSFEEDDDDDWDDWDDGCTVVEEPRAGGLGTNGHPPLNLSYPGA
  YPSQHMAFRPKPPLERQDSLASAKRGSVVGRNLNRFSCFVRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKA
  NPHPFACSVEDPTKQTKFKGIKSYISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEE
  DFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVE
  DRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSAFQAISHSFQMDPPFCSEALNSAISHTGRTY
  EAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGF
  ALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDNL

• Structural information:
  • Protein Domains: (1..6-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (230..34-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147-)
    (371..57-)
    (/note="BAR"-)
  • Interpro: IPR027267  IPR001683  IPR036871  IPR036028  IPR001452   IPR028642  IPR037427  IPR014536  IPR019497  
  • Prosite: PS50195 PS50002
  • CDD: cd07669
  • PDB: 4AKV
  • PDBsum: 4AKV
  • STRING: ENSP00000311427
• Other Databases: GeneCards:  SNX33  Malacards:  SNX33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0097320	plasma membrane tubulation	IDA	biological process
GO:0007032	endosome organization	IMP	biological process
GO:0044351	macropinocytosis	IMP	biological process
GO:0036089	cleavage furrow formation	IMP	biological process
GO:0016197	endosomal transport	IMP	biological process
GO:0006897	endocytosis	IMP	biological process
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0019898	extrinsic component of membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0000281	mitotic cytokinesis	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:2000010	positive regulation of protein localization to cell surface	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:2000009	negative regulation of protein localization to cell surface	IDA	biological process
GO:2000010	positive regulation of protein localization to cell surface	IDA	biological process
GO:0017038	protein import	IDA	biological process
GO:0045806	negative regulation of endocytosis	IDA	biological process
GO:0017038	protein import	IDA	biological process
GO:0045806	negative regulation of endocytosis	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq