• Gene id: 257313

Gene Summary

• Gene Symbol: UTS2B   Gene   UCSC   Ensembl
• Aliases: U2B, URP, UTS2D
• Gene name: urotensin 2B
• Alternate names: urotensin-2B, U-IIB, UIIB, prepro-URP, urotensin 2 domain containing, urotensin II-related peptide, urotensin IIB, urotensin-2 domain-containing protein,
• Gene location: 3q28 (191330535: 191266464)     Exons: 11     NC_000003.12
• OMIM: 618134

Protein Summary

• Protein general information: Q765I0  
  • Name: Urotensin 2B (Urotensin II related peptide) (Urotensin IIB) (U IIB) (UIIB) (Urotensin 2 domain containing protein)
  • Length: 119  
  • Mass: 13749
• Sequence:

  MNKILSSTVCFGLLTLLSVLSFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKL
  EELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV

• Structural information:
  • Interpro: IPR001483  
  • Prosite: PS00984
  • STRING: ENSP00000340526
• Other Databases: GeneCards:  UTS2B  Malacards:  UTS2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008217	regulation of blood pressure	IBA	biological process
GO:0001664	G protein-coupled receptor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0097746	regulation of blood vessel diameter	IEA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0001664	G protein-coupled receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq