• Gene id: 257194

Gene Summary

• Gene Symbol: NEGR1   Gene   UCSC   Ensembl
• Aliases: DMML2433, IGLON4, KILON, Ntra
• Gene name: neuronal growth regulator 1
• Alternate names: neuronal growth regulator 1, IgLON family member 4, a kindred of IgLON, neurotractin,
• Gene location: 1p31.1 (203861598: 203871151)     Exons: 6     NC_000001.11
• OMIM: 613173

Protein Summary

• Protein general information: Q7Z3B1  
  • Name: Neuronal growth regulator 1 (IgLON family member 4)
  • Length: 354  
  • Mass: 38719
• Sequence:

  MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGASKGAWLNRS
  SIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTV
  NEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAP
  TIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAA
  NKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKNAILQ

• Structural information:
  • Protein Domains: (38..13-)
    1 (/note="Ig-like-C2-type)
    (139..22-)
    2 (/note="Ig-like-C2-type)
    (225..31-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  
  • Prosite: PS50835
  • PDB: 6DLD
  • PDBsum: 6DLD
  • STRING: ENSP00000350364
• Other Databases: GeneCards:  NEGR1  Malacards:  NEGR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq