• Gene id: 257062

Gene Summary

• Gene Symbol: CATSPERD   Gene   UCSC   Ensembl
• Aliases: TMEM146
• Gene name: cation channel sperm associated auxiliary subunit delta
• Alternate names: cation channel sperm-associated protein subunit delta, catSper-delta, catSperdelta, catsper channel auxiliary subunit delta, transmembrane protein 146,
• Gene location: 19p13.3 (5720155: 5778733)     Exons: 25     NC_000019.10
• OMIM: 617490

Protein Summary

• Protein general information: Q86XM0  
  • Name: Cation channel sperm associated protein subunit delta (CatSper delta) (CatSperdelta) (Transmembrane protein 146)
  • Length: 798  
  • Mass: 90468
• Sequence:

  MLMLMLVAAVTMWLRPLVTAQLCRSRTVRTGKVFNLIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTM
  DNFETSLLPFTIPTSMQVGVPEVTSAHFAGSLLLLVVDQKVYIYDYENNSWSMSLGIKHPVTHVSGDNCCYTGSL
  FCVHVSNLVFAYFRGDQISQTYIYYSNTGGFSFWKYHYDRQAEIIGSLGGIFHFFSLSQVAMLVVNQGKGMFKYS
  DHPLNRSFGLSFDYNGTLDILIAPGQRGILLLWFENSLLFSHNAGQLVDTVRVKKGDQTLFSSIFEAKITIHNIA
  VTENELAVITREDNLYYGNLGIVPSSIIKFADQYIWSEDVALMFRSPGTLEILTPLRDTAFPAFDFQKCLVNIQA
  LLMDPELHVGKCKIEFLTGEFIYRMYTIDMHSQLELTASLIPQPGTSLIPLVMVSNPHSLGFQATFYENGYTSDG
  NTKYKLDIFLKQQQHWGRTDSNFTSSLKKATMSTLTVDIANKEISCVDIKPLSTLISVGCDLDKKIVIQNKVSAC
  SMGILDPLTLQDNYSFIIEKEFYDPGFQGQQSSEDLHVFYSYQQLGCPLLVYYDTLWKPVVELWRKDSFQEVIDA
  EYVLLEVNGQFSYSYSLTAQSAMCTSQPQNWTTMIKEFGGPFFWNRENYVSCHDPNNNAPLRWPDVQYQILGGRT
  ANQIIFGHNGFYVFYISIVDPYYSYCQLETIFSIYVYGAFPVQLVSAGVVILLIISSILGSVWLAYKTPKLLRTA
  RGRRIKKCATQLCRRCKTVCQFRASATARAGTEPPGRHRTPHGGRSDH

• Structural information:
  • Interpro: IPR028751  
  • STRING: ENSP00000371037
• Other Databases: GeneCards:  CATSPERD  Malacards:  CATSPERD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036128	CatSper complex	ISS	cellular component
GO:0007283	spermatogenesis	ISS	biological process
GO:0030317	flagellated sperm motility	ISS	biological process
GO:0036128	CatSper complex	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035036	sperm-egg recognition	TAS	biological process
GO:0032570	response to progesterone	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048240	sperm capacitation	ISS	biological process
GO:0097228	sperm principal piece	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq