• Gene id: 256933

Gene Summary

• Gene Symbol: NPB   Gene   UCSC   Ensembl
• Aliases: L7, PPL7, PPNPB
• Gene name: neuropeptide B
• Alternate names: neuropeptide B, prepro-NPB, preproneuropeptide B, preproprotein L7,
• Gene location: 17q25.3 (81902237: 81902904)     Exons: 2     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the neuropeptide B/W family of proteins and preproprotein that is proteolytically processed to generate multiple protein products. The encoded products include neuropeptide B-23 and a C-terminally extended form, neuropeptide
• OMIM: 604157

Protein Summary

• Protein general information: Q8NG41  
  • Name: Neuropeptide B (Preproprotein L7) (hPPL7) [Cleaved into: Neuropeptide B 23 (NPB23) (hL7); Neuropeptide B 29 (NPB29) (hL7C)]
  • Length: 125  
  • Mass: 13097
  • Tissue specificity: Widely expressed in the central nervous system. High levels are found in substantia nigra, hypothalamus, hyppocampus, spinal cord, placenta and fetal brain; lower levels are found in testis, uterus and ovary. Also detected at high leve
• Sequence:

  MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYRGAEPPGGAGASPELQ
  LHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA

• Structural information:
  • Interpro: IPR013298  IPR013297  
  • STRING: ENSP00000332766
• Other Databases: GeneCards:  NPB  Malacards:  NPB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001664	G protein-coupled receptor binding	IBA	molecular function
GO:0007631	feeding behavior	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0001664	G protein-coupled receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0001664	G protein-coupled receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881