• Gene id: 255967

Gene Summary

• Gene Symbol: PAN3   Gene   UCSC   Ensembl
• Gene name: poly(A) specific ribonuclease subunit PAN3
• Alternate names: PAN2-PAN3 deadenylation complex subunit PAN3, PAB-dependent poly(A)-specific ribonuclease subunit 3, PAB-dependent poly(A)-specific ribonuclease subunit PAN3, PAB1P-dependent poly(A)-nuclease, PAB1P-dependent poly(A)-specific ribonuclease, PABP-dependent poly(,
• Gene location: 13q12.2 (28135020: 28295334)     Exons: 25     NC_000013.11
• OMIM: 617448

Protein Summary

• Protein general information: Q58A45  
  • Name: PAN2 PAN3 deadenylation complex subunit PAN3 (PAB1P dependent poly(A) specific ribonuclease) (Poly(A) nuclease deadenylation complex subunit 3) (PAN deadenylation complex subunit 3)
  • Length: 887  
  • Mass: 95613
• Sequence:

  MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCRYYAKDKTCFYGEECQFLHEDPAAGA
  APGLGLHSNSVPLALAGAPVAGFPPGAVAGGGAGPPPGPKKPDLGDPGTGAAAGGGGSSGGLDGPRLAIPGMDGG
  ALTDTSLTDSYFSTSFIGVNGFGSPVETKYPLMQRMTNSSSSPSLLNDSAKPYSAHDPLTSPASSLFNDFGALNI
  SQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGST
  SRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNPASYMVPSSA
  STSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELR
  QELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHG
  FRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQH
  EGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVGVFDVLTFDNSQNNNP
  LALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIG
  ARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEA
  GAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL

• Structural information:
  • Interpro: IPR011009  IPR030844  IPR041332  IPR000719  IPR000571   IPR036855  
  • Prosite: PS50011 PS50103
  • DIP: 53755
  • STRING: ENSP00000370345
• Other Databases: GeneCards:  PAN3  Malacards:  PAN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IBA	biological process
GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly	IBA	biological process
GO:0031251	PAN complex	IBA	cellular component
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0004535	poly(A)-specific ribonuclease activity	IBA	contributes to
GO:0004535	poly(A)-specific ribonuclease activity	IDA	contributes to
GO:0031251	PAN complex	IDA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0031251	PAN complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006605	protein targeting	IEA	biological process
GO:0000932	P-body	IEA	cellular component
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IEA	biological process
GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly	IEA	biological process
GO:0000932	P-body	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IEA	biological process
GO:0000932	P-body	IEA	cellular component
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IEA	biological process
GO:0031251	PAN complex	IEA	cellular component
GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq