• Gene id: 255877

Gene Summary

• Gene Symbol: BCL6B   Gene   UCSC   Ensembl
• Aliases: BAZF, ZBTB28, ZNF62
• Gene name: BCL6B transcription repressor
• Alternate names: B-cell CLL/lymphoma 6 member B protein, B cell CLL/lymphoma 6B, B-cell CLL/lymphoma 6, member B (zinc finger protein), bcl6-associated zinc finger protein, zinc finger protein 62,
• Gene location: 17p13.1 (7023049: 7029643)     Exons: 9     NC_000017.11
• OMIM: 608992

Protein Summary

• Protein general information: Q8N143  
  • Name: B cell CLL/lymphoma 6 member B protein (Bcl6 associated zinc finger protein) (Zinc finger protein 62)
  • Length: 479  
  • Mass: 51531
  • Tissue specificity: Ubiquitously expressed with higher expression found in heart and placenta. {ECO
• Sequence:

  MGSPAAPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACSGFFYSIFRGRAGVGV
  DVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQMEHVVQACHRFIQASYEPLGISLRPLEAEPP
  TPPTAPPPGSPRRSEGHPDPPTESRSCSQGPPSPASPDPKACNWKKYKYIVLNSQASQAGSLVGERSSGQPCPQA
  RLPSGDEASSSSSSSSSSSEEGPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEF
  FSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSICGARFNRPANLKTHS
  RIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQTLKSHVRIHTGEKPYHCDPCGLHFR
  HKSQLRLHLRQKHGAATNTKVHYHILGGP

• Structural information:
  • Protein Domains: (38..10-)
    (/note="BTB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00037"-)
  • Interpro: IPR000210  IPR011333  IPR036236  IPR013087  
  • Prosite: PS50097 PS00028 PS50157
  • STRING: ENSP00000293805
• Other Databases: GeneCards:  BCL6B  Malacards:  BCL6B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	molecular function
GO:0042092	type 2 immune response	IBA	biological process
GO:0045595	regulation of cell differentiation	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001817	regulation of cytokine production	IBA	biological process
GO:0002682	regulation of immune system process	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0050727	regulation of inflammatory response	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq