• Gene id: 255798

Gene Summary

• Gene Symbol: SMCO1   Gene   UCSC   Ensembl
• Aliases: C3orf43
• Gene name: single-pass membrane protein with coiled-coil domains 1
• Alternate names: single-pass membrane and coiled-coil domain-containing protein 1,
• Gene location: 3q29 (196520955: 196506878)     Exons: 4     NC_000003.12

Protein Summary

• Protein general information: Q147U7  
  • Name: Single pass membrane and coiled coil domain containing protein 1 (Single pass membrane protein with coiled coil domains 1)
  • Length: 214  
  • Mass: 24598
• Sequence:

  MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQAAQDEMWTAVRALQLTSMELNI
  LYSYVIEVLICLHTRVLEKLPDLVRGLPTLASVLRRKVKNKRVRVVWESILEECGLQEGDITALCTFFIARGNKA
  EHYTAKVRQMYIRDVTFLITNMVKNQALQDSLLRAVQVIEKGKAVRTPEKQKSSLEELIPSVKN

• Structural information:
  • Interpro: IPR027875  
  • STRING: ENSP00000380671
• Other Databases: GeneCards:  SMCO1  Malacards:  SMCO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)