• Gene id: 255758

Gene Summary

• Gene Symbol: TCTEX1D2   Gene   UCSC   Ensembl
• Aliases: SRTD17
• Gene name: Tctex1 domain containing 2
• Alternate names: tctex1 domain-containing protein 2,
• Gene location: 3q29 (196318239: 196291218)     Exons: 5     NC_000003.12
• Gene summary(Entrez): Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transp
• OMIM: 300616

Protein Summary

• Protein general information: Q8WW35  
  • Name: Tctex1 domain containing protein 2
  • Length: 142  
  • Mass: 16122
• Sequence:

  MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSE
  NIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCFYY

• Structural information:
  • Interpro: IPR005334  IPR038586  
  • STRING: ENSP00000324323
• Other Databases: GeneCards:  TCTEX1D2  Malacards:  TCTEX1D2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000922	spindle pole	IDA	colocalizes with
GO:0031021	interphase microtubule organizing center	IDA	colocalizes with
GO:0005813	centrosome	IDA	colocalizes with
GO:0005868	cytoplasmic dynein complex	IDA	cellular component
GO:0005868	cytoplasmic dynein complex	IDA	cellular component
GO:0005930	axoneme	IDA	colocalizes with
GO:0045505	dynein intermediate chain binding	IPI	molecular function
GO:0045505	dynein intermediate chain binding	IPI	molecular function
GO:1902017	regulation of cilium assembly	IMP	biological process
GO:0097546	ciliary base	IDA	colocalizes with
GO:0060271	cilium assembly	IMP	biological process
GO:1905799	regulation of intraciliary retrograde transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Short-rib thoracic dysplasia	KEGG:H02157
Short-rib thoracic dysplasia	KEGG:H02157
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray