About Us

Search Result


Gene id 2556
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol GABRA3   Gene   UCSC   Ensembl
Gene name gamma-aminobutyric acid type A receptor subunit alpha3
Alternate names gamma-aminobutyric acid receptor subunit alpha-3, GABA(A) receptor subunit alpha-3, GABA(A) receptor, alpha 3, gamma-aminobutyric acid (GABA) A receptor, alpha 3, gamma-aminobutyric acid type A receptor alpha3 subunit, gamma-animobutyric acid (GABA) A receptor,
Gene location Xq28 (152451340: 152166233)     Exons: 10     NC_000023.11
Gene summary(Entrez) GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GA
OMIM 615319

Protein Summary

Protein general information P34903  

Name: Gamma aminobutyric acid receptor subunit alpha 3 (GABA(A) receptor subunit alpha 3)

Length: 492  Mass: 55165

Sequence MIITQTSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLL
DGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPD
TFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTL
GKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWEGKKVP
EALEMKKKTPAAPAKKTSTTFNIVGTTYPINLAKDTEFSTISKGAAPSASSTPTIIASPKATYVQDSPTETKTYN
SVSKVDKISRIIFPVLFAIFNLVYWATYVNRESAIKGMIRKQ
Structural information
Interpro:  IPR006028  IPR001390  IPR005433  IPR006202  IPR036734  
IPR006201  IPR036719  IPR006029  IPR018000  
Prosite:   PS00236
STRING:   ENSP00000359337
Other Databases GeneCards:  GABRA3  Malacards:  GABRA3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:1904315 transmitter-gated ion cha
nnel activity involved in
regulation of postsynapt
ic membrane potential
IBA molecular function
GO:1902476 chloride transmembrane tr
ansport
IBA biological process
GO:0098794 postsynapse
IBA cellular component
GO:0060078 regulation of postsynapti
c membrane potential
IBA biological process
GO:0051932 synaptic transmission, GA
BAergic
IBA biological process
GO:0050877 nervous system process
IBA biological process
GO:0043005 neuron projection
IBA cellular component
GO:0022851 GABA-gated chloride ion c
hannel activity
IBA molecular function
GO:0007268 chemical synaptic transmi
ssion
IBA biological process
GO:0007165 signal transduction
IBA biological process
GO:0004890 GABA-A receptor activity
IBA contributes to
GO:1902711 GABA-A receptor complex
IBA cellular component
GO:0045202 synapse
IBA cellular component
GO:0042391 regulation of membrane po
tential
IBA biological process
GO:0034220 ion transmembrane transpo
rt
IBA biological process
GO:0032590 dendrite membrane
IBA cellular component
GO:0030594 neurotransmitter receptor
activity
IBA molecular function
GO:0008503 benzodiazepine receptor a
ctivity
IBA contributes to
GO:0007214 gamma-aminobutyric acid s
ignaling pathway
IBA biological process
GO:0005887 integral component of pla
sma membrane
IBA cellular component
GO:0005254 chloride channel activity
IBA molecular function
GO:0005254 chloride channel activity
IBA contributes to
GO:0005237 inhibitory extracellular
ligand-gated ion channel
activity
IBA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0004890 GABA-A receptor activity
IEA molecular function
GO:0005230 extracellular ligand-gate
d ion channel activity
IEA molecular function
GO:0006821 chloride transport
IEA biological process
GO:0004888 transmembrane signaling r
eceptor activity
IEA molecular function
GO:0005216 ion channel activity
IEA molecular function
GO:0006811 ion transport
IEA biological process
GO:0007214 gamma-aminobutyric acid s
ignaling pathway
IEA biological process
GO:0016020 membrane
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0034220 ion transmembrane transpo
rt
IEA biological process
GO:0034707 chloride channel complex
IEA cellular component
GO:0006821 chloride transport
IEA biological process
GO:0030054 cell junction
IEA cellular component
GO:0006811 ion transport
IEA biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0045202 synapse
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005254 chloride channel activity
IEA molecular function
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0045211 postsynaptic membrane
IEA cellular component
GO:0008503 benzodiazepine receptor a
ctivity
TAS molecular function
GO:0005887 integral component of pla
sma membrane
TAS cellular component
GO:0007214 gamma-aminobutyric acid s
ignaling pathway
TAS biological process
GO:0005886 plasma membrane
TAS cellular component
GO:0004890 GABA-A receptor activity
IEA molecular function
GO:0007268 chemical synaptic transmi
ssion
IEA biological process
GO:1904315 transmitter-gated ion cha
nnel activity involved in
regulation of postsynapt
ic membrane potential
IEA molecular function
GO:1904315 transmitter-gated ion cha
nnel activity involved in
regulation of postsynapt
ic membrane potential
IEA molecular function
GO:0045202 synapse
IEA cellular component
GO:0098982 GABA-ergic synapse
IEA cellular component
GO:0099060 integral component of pos
tsynaptic specialization
membrane
IEA cellular component
GO:0098982 GABA-ergic synapse
IEA cellular component
GO:0099060 integral component of pos
tsynaptic specialization
membrane
IEA cellular component
GO:0045211 postsynaptic membrane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04080Neuroactive ligand-receptor interaction
hsa04723Retrograde endocannabinoid signaling
hsa05032Morphine addiction
hsa04727GABAergic synapse
hsa04742Taste transduction
hsa05033Nicotine addiction
Associated diseases References
Multiple sclerosis PMID:9561979
Bipolar disorder PMID:11840313
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract