• Gene id: 255220

Gene Summary

• Gene Symbol: TXNDC8   Gene   UCSC   Ensembl
• Aliases: SPTRX-3, SPTRX3, TRX6, bA427L11.2
• Gene name: thioredoxin domain containing 8
• Alternate names: thioredoxin domain-containing protein 8, sperm-specific thioredoxin 3, spermatid-specific thioredoxin-3, spermatocyte/spermatid-specific thioredoxin-3, thioredoxin 6, thioredoxin domain containing 8 (spermatozoa),
• Gene location: 9q31.3 (110337886: 110300899)     Exons: 11     NC_000009.12
• OMIM: 617789

Protein Summary

• Protein general information: Q6A555  
  • Name: Thioredoxin domain containing protein 8 (Spermatid specific thioredoxin 3) (Sptrx 3) (Thioredoxin 6)
  • Length: 127  
  • Mass: 14,575
• Sequence:

  MVQIIKDTNEFKTFLTAAGHKLAVVQFSSKRCGPCKRMFPVFHAMSVKYQNVFFANVDVNNSPELAETCHIKTIP
  TFQMFKKSQKVTLFSRIKRIICCYRSGFMSNLIFEFCGADAKKLEAKTQELM

• Structural information:
  • Protein Domains: Thioredoxin. (1-92)
  • Interpro: IPR005746  IPR036249  IPR013766  
  • STRING: ENSP00000363634
• Other Databases: GeneCards:  TXNDC8  Malacards:  TXNDC8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000103	sulfate assimilation	IBA	biological process
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0001675	acrosome assembly	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006457	protein folding	IBA	biological process
GO:0006662	glycerol ether metabolic process	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEP	biological process
GO:0007283	spermatogenesis	IEP	biological process
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	IBA	molecular function
GO:0034599	cellular response to oxidative stress	IBA	biological process
GO:0036126	sperm flagellum	IEA	cellular component
GO:0045454	cell redox homeostasis	IBA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0015035	protein disulfide oxidoreductase activity	IDA	molecular function
GO:0000103	sulfate assimilation	IBA	biological process
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0001675	acrosome assembly	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006457	protein folding	IBA	biological process
GO:0006662	glycerol ether metabolic process	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	IEP	biological process
GO:0007283	spermatogenesis	IEP	biological process
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	IBA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0034599	cellular response to oxidative stress	IBA	biological process
GO:0036126	sperm flagellum	IEA	cellular component
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0045454	cell redox homeostasis	IBA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0015035	protein disulfide oxidoreductase activity	IDA	molecular function
GO:0000103	sulfate assimilation	IBA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006457	protein folding	IBA	biological process
GO:0007283	spermatogenesis	IEP	biological process
GO:0007283	spermatogenesis	IEP	biological process
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	IBA	molecular function
GO:0034599	cellular response to oxidative stress	IBA	biological process
GO:0045454	cell redox homeostasis	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0015035	protein disulfide oxidoreductase activity	IDA	molecular function

Diseases

Associated diseases	References
Pregnancy rate	MIK: 23734172
Azoospermia	MIK: 24728569
Azoospermia	MIK: 24728569
Pregnancy rate	MIK: 23734172
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23734172	Pregnancy rate			218 (72 male infertility patients, 61 couples with unexplained, idiopathic infertility, 85 female-only infertility)	Male infertility
24728569	Azoospermia			114 (83 semen samples, 31 non-obstructive azoospermia)	Male infertility	TSPY1 DAZ SPTRX3 and SPTRX1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)