• Gene id: 255061

Gene Summary

• Gene Symbol: TAC4   Gene   UCSC   Ensembl
• Aliases: EK, HK-1, HK1, PPT-C
• Gene name: tachykinin precursor 4
• Alternate names: tachykinin-4, endokinin, preprotachykinin-C, tachykinin 4 (hemokinin),
• Gene location: 17q21.33 (49848016: 49838308)     Exons: 13     NC_000017.11
• Gene summary(Entrez): This gene is a member of the tachykinin family of neurotransmitter-encoding genes. Tachykinin proteins are cleaved into small, secreted peptides that activate members of a family of receptor proteins. The products of this gene preferentially activate tach
• OMIM: 607833

Protein Summary

• Protein general information: Q86UU9  
  • Name: Tachykinin 4 (Preprotachykinin C) (PPT C) [Cleaved into: Endokinin A (EKA); Endokinin A/B (EKA/B); Endokinin C (EKC)]
  • Length: 113  
  • Mass: 12305
  • Tissue specificity: Expressed at low levels in the uterus of both pregnant and non-pregnant women. Isoform 1 is found only in the adrenal gland and fetal liver. Isoform 2 is found in heart, liver, bone marrow, prostate, adrenal gland and testis. Isoform 3
• Sequence:

  MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGGRP
  LIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQGSE

• Structural information:
  • Interpro: IPR013055  
  • Prosite: PS00267
  • PDB: 2MOC
  • PDBsum: 2MOC
  • STRING: ENSP00000334042
• Other Databases: GeneCards:  TAC4  Malacards:  TAC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0007217	tachykinin receptor signaling pathway	IBA	biological process
GO:0031835	substance P receptor binding	IBA	molecular function
GO:0006954	inflammatory response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:1902093	positive regulation of flagellated sperm motility	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)