• Gene id: 255027

Gene Summary

• Gene Symbol: MPV17L   Gene   UCSC   Ensembl
• Aliases: M-LPH, MLPH1, MLPH2, MPV17L1
• Gene name: MPV17 mitochondrial inner membrane protein like
• Alternate names: mpv17-like protein, M-LP homolog, MPV17 mitochondrial membrane protein-like, Mpv17-like protein type 1, Mpv17-like protein type 2,
• Gene location: 16p13.11 (15395568: 15413270)     Exons: 5     NC_000016.10
• OMIM: 614694

Protein Summary

• Protein general information: Q2QL34  
  • Name: Mpv17 like protein (M LP homolog) (M LPH)
  • Length: 196  
  • Mass: 22116
  • Tissue specificity: Isoform 1 is detected in the kidney (at protein level). Isoform 1 and isoform 2 are expressed in the kidney, heart, liver, lung, pancreas and skeletal muscle. {ECO
• Sequence:

  MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRRVATLVVTFHANFNYVWLRLLERALP
  GRAPHALLAKLLCDQVVGAPIAVSAFYVGMSILQGKDDIFLDLKQKFWNTYLSGLMYWPFVQLTNFSLVPVQWRT
  AYAGVCGFLWATFICFSQQSGDGTFKSAFTILYTKGTSATEGYPKK

• Structural information:
  • Interpro: IPR007248  
  • STRING: ENSP00000379669
• Other Databases: GeneCards:  MPV17L  Malacards:  MPV17L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0010730	negative regulation of hydrogen peroxide biosynthetic process	IDA	biological process
GO:1901029	negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IDA	biological process
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881