• Gene id: 254887

Gene Summary

• Gene Symbol: ZDHHC23   Gene   UCSC   Ensembl
• Aliases: DHHC-23, NIDD
• Gene name: zinc finger DHHC-type palmitoyltransferase 23
• Alternate names: palmitoyltransferase ZDHHC23, zinc finger DHHC domain-containing protein 23, zinc finger DHHC-type containing 23,
• Gene location: 3q13.31 (19431732: 19330697)     Exons: 25     NC_000022.11
• OMIM: 617334

Protein Summary

• Protein general information: Q8IYP9  
  • Name: Palmitoyltransferase ZDHHC23 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 23) (DHHC 23) (zDHHC23)
  • Length: 409  
  • Mass: 45983
• Sequence:

  MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKSLQPETCERIMDTISD
  RLRIPWLRGAKKVNISIIPPLVLLPVFLHVASWHFLLGVVVLTSLPVLALWYYYLTHRRKEQTLFFLSLGLFSLG
  YMYYVFLQEVVPKGRVGPVQLAVLTCGLFLILLALHRAKKNPGYLSNPASGDRSLSSSQLECLSRKGQEKTKGFP
  GADMSGSLNNRTTKDDPKGSSKMPAGSPTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESN
  HQAFILALLIFLLTSVYGITLTLDTICRDRSVFTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLIN
  ISYNVTEREVQQALRQKTGRRLLCGLIVDTGLLG

• Structural information:
  • Protein Domains: (259..30-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000330485
• Other Databases: GeneCards:  ZDHHC23  Malacards:  ZDHHC23

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0018345	protein palmitoylation	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)