• Gene id: 254879

Gene Summary

• Gene Symbol: OR2T6   Gene   UCSC   Ensembl
• Aliases: OR2T6P, OR2T9, OST703
• Gene name: olfactory receptor family 2 subfamily T member 6
• Alternate names: olfactory receptor 2T6, olfactory receptor 2T9, olfactory receptor, family 2, subfamily T, member 6 pseudogene, seven transmembrane helix receptor,
• Gene location: 1q44 (248387608: 248388534)     Exons: 1     NC_000001.11
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
• OMIM: 120355

Protein Summary

• Protein general information: Q8NHC8  
  • Name: Olfactory receptor 2T6 (OST703) (Olfactory receptor 2T9)
  • Length: 308  
  • Mass: 34765
• Sequence:

  MNENNETLTRGFTLMGLFTHNKCSGFFFGVICAVFFMAMIANGVMIFLINIDPHLHTPMYFLLSHLSVIDTLYIS
  TIVPKMLVDYLMGEGTISFIACTAQCFLYMGFMGAEFFLLGLMAYDRYVAICNPLRYPVLISWRVCWMILASSWF
  GGALDSFLLTPITMSLPFCASHQINHFFCEAPTMLRLACGDKTTYETVMYVCCVAMLLIPFSVVTASYTRILITV
  HQMTSAEGRKKAFATCSSHMMVVTLFYGAALYTYTLPQSYHTPIKDKVFSAFYTILTPLLNPLIYSLRNRDVMGA
  LKRVVARC

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000347965
• Other Databases: GeneCards:  OR2T6  Malacards:  OR2T6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray