• Gene id: 254528

Gene Summary

• Gene Symbol: MEIOB   Gene   UCSC   Ensembl
• Aliases: C16orf73, SPGF22, gs129
• Gene name: meiosis specific with OB-fold
• Alternate names: meiosis-specific with OB domain-containing protein, meiosis specific with OB domains,
• Gene location: 16p13.3 (1872163: 1833985)     Exons: 14     NC_000016.10
• OMIM: 617670

Protein Summary

• Protein general information: Q8N635  
  • Name: Meiosis specific with OB domain containing protein (EC 3.1. . )
  • Length: 442  
  • Mass: 49313
  • Tissue specificity: In fetal gonads, specifically expressed in the ovary starting at the 14th weeks post fertilization (PubMed
• Sequence:

  MANSFAARIFTTLSDLQTNMANLKVIGIVIGKTDVKGFPDRKNIGSERYTFSFTIRDSPAHFVNAASWGNEDYIK
  SLSDSFRVGDCVIIENPLIQRKEIEREEKFSPATPSNCKLLLSENHSTVKVCSSYEVDTKLLSLIHLPVKESHDY
  YSLGDIVANGHSLNGRIINVLAAVKSVGEPKYFTTSDRRKGQRCEVRLYDETESSFAMTCWDNESILLAQSWMPR
  ETVIFASDVRINFDKFRNCMTATVISKTIITTNPDIPEANILLNFIRENKETNVLDDEIDSYFKESINLSTIVDV
  YTVEQLKGKALKNEGKADPSYGILYAYISTLNIDDETTKVVRNRCSSCGYIVNEASNMCTTCNKNSLDFKSVFLS
  FHVLIDLTDHTGTLHSCSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKHV

• Structural information:
  • Interpro: IPR012340  
  • STRING: ENSP00000390778
• Other Databases: GeneCards:  MEIOB  Malacards:  MEIOB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008310	single-stranded DNA 3'-5' exodeoxyribonuclease activity	IBA	molecular function
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000712	resolution of meiotic recombination intermediates	IBA	biological process
GO:0009566	fertilization	ISS	biological process
GO:0008310	single-stranded DNA 3'-5' exodeoxyribonuclease activity	ISS	molecular function
GO:0007140	male meiotic nuclear division	ISS	biological process
GO:0007129	synapsis	ISS	biological process
GO:0003682	chromatin binding	ISS	molecular function
GO:0007144	female meiosis I	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0003697	single-stranded DNA binding	ISS	molecular function
GO:0000724	double-strand break repair via homologous recombination	ISS	biological process
GO:0000712	resolution of meiotic recombination intermediates	ISS	biological process
GO:0004518	nuclease activity	IEA	molecular function
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007129	synapsis	IEA	biological process
GO:0007140	male meiotic nuclear division	IEA	biological process
GO:0008310	single-stranded DNA 3'-5' exodeoxyribonuclease activity	IEA	molecular function
GO:0009566	fertilization	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0007141	male meiosis I	IEA	biological process
GO:0007144	female meiosis I	IEA	biological process
GO:0000712	resolution of meiotic recombination intermediates	IEA	biological process
GO:0000724	double-strand break repair via homologous recombination	IEA	biological process
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic failure	KEGG:H01282
Spermatogenic failure	KEGG:H01282
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia and testicular meiotic arrest	MIK: 30838384
Sperm number defects	MIK: 29713536
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29713536	Sperm number defects	c.A191T (p.N64I)			Male infertility	NGS
30838384	Azoospermia and testicular meiotic arrest		Arab an d other ethnic ities	159 infertile and 77 fertile men, 2 infertile arab men, 136 infertile and 77 fertile men, 21 NOA men	Male infertility	NGS
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881