• Gene id: 254428

Gene Summary

• Gene Symbol: SLC41A1   Gene   UCSC   Ensembl
• Aliases: MgtE
• Gene name: solute carrier family 41 member 1
• Alternate names: solute carrier family 41 member 1, solute carrier family 41 (magnesium transporter), member 1,
• Gene location: 1q32.1 (13279691: 13105295)     Exons: 51     NC_000009.12
• OMIM: 610801

Protein Summary

• Protein general information: Q8IVJ1  
  • Name: Solute carrier family 41 member 1
  • Length: 513  
  • Mass: 54901
  • Tissue specificity: Highest expression levels in heart and testis, slightly less in skeletal muscles, prostate, adrenal gland and thyroid, and weakest in the hematopoietic tissues bones marrow, lymph node, thymus and spleen. {ECO
• Sequence:

  MSSKPEPKDVHQLNGTGPSASPCSSDGPGREPLAGTSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNE
  SDDVSTDRGPAPPSPLKETSFSIGLQVLFPFLLAGFGTVAAGMVLDIVQHWEVFQKVTEVFILVPALLGLKGNLE
  MTLASRLSTAANIGHMDTPKELWRMITGNMALIQVQATVVGFLASIAAVVFGWIPDGHFSIPHAFLLCASSVATA
  FIASLVLGMIMIGVIIGSRKIGINPDNVATPIAASLGDLITLALLSGISWGLYLELNHWRYIYPLVCAFFVALLP
  VWVVLARRSPATREVLYSGWEPVIIAMAISSVGGLILDKTVSDPNFAGMAVFTPVINGVGGNLVAVQASRISTFL
  HMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSARVLFLLVVPGHLVFLYTISCMQGGHTTLTLIFIIFYMTAAL
  LQVLILLYIADWMVHWMWGRGLDPDNFSIPYLTALGDLLGTGLLALSFHVLWLIGDRDTDVGD

• Structural information:
  • Interpro: IPR006667  IPR036739  
  • STRING: ENSP00000356105
• Other Databases: GeneCards:  SLC41A1  Malacards:  SLC41A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015095	magnesium ion transmembrane transporter activity	IDA	molecular function
GO:0022857	transmembrane transporter activity	IDA	molecular function
GO:0022857	transmembrane transporter activity	IDA	molecular function
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0061768	magnesium:sodium antiporter activity	IMP	molecular function
GO:0022857	transmembrane transporter activity	IMP	molecular function
GO:0015693	magnesium ion transport	IDA	biological process
GO:0015693	magnesium ion transport	IDA	biological process
GO:0015693	magnesium ion transport	IDA	biological process
GO:0072509	divalent inorganic cation transmembrane transporter activity	ISS	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0015693	magnesium ion transport	IMP	biological process
GO:0010961	cellular magnesium ion homeostasis	IMP	biological process
GO:0070838	divalent metal ion transport	ISS	biological process
GO:0071286	cellular response to magnesium ion	ISS	biological process
GO:0071286	cellular response to magnesium ion	IGI	biological process
GO:1903830	magnesium ion transmembrane transport	IDA	biological process
GO:1903830	magnesium ion transmembrane transport	ISS	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006812	cation transport	IEA	biological process
GO:0008324	cation transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071286	cellular response to magnesium ion	IEA	biological process
GO:0070838	divalent metal ion transport	IEA	biological process
GO:1903830	magnesium ion transmembrane transport	IEA	biological process
GO:0072509	divalent inorganic cation transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0035725	sodium ion transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)