• Gene id: 2542

Gene Summary

• Gene Symbol: SLC37A4   Gene   UCSC   Ensembl
• Aliases: G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d, PRO0685, TRG-19, TRG19
• Gene name: solute carrier family 37 member 4
• Alternate names: glucose-6-phosphate exchanger SLC37A4, glucose-5-phosphate transporter, glucose-6-phosphatase, transport (glucose) protein 3, glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1, glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein ,
• Gene location: 11q23.3 (119030905: 119024111)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, in order to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of the endoplasmic reticulum.
• OMIM: 602671

Protein Summary

• Protein general information: O43826  
  • Name: Glucose 6 phosphate exchanger SLC37A4 (Glucose 5 phosphate transporter) (Glucose 6 phosphate translocase) (Solute carrier family 37 member 4) (Transformation related gene 19 protein) (TRG 19)
  • Length: 429  
  • Mass: 46360
  • Tissue specificity: Mostly expressed in liver and kidney.
• Sequence:

  MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMS
  ARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGG
  LGPILATILAQSYSWRSTLALSGALCVVVSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPY
  LWVLSTGYLVVFGVKTCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPR
  HGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFGVIANESAPPNLCGTSHAIVGLMANV
  GGFLAGLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLLRNIRTKMGRVSKKAE

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  IPR021159  IPR000849  
  • Prosite: PS00942 PS50850
  • STRING: ENSP00000476176
• Other Databases: GeneCards:  SLC37A4  Malacards:  SLC37A4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015760	glucose-6-phosphate transport	IDA	biological process
GO:0061513	glucose 6-phosphate:inorganic phosphate antiporter activity	IDA	molecular function
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0035435	phosphate ion transmembrane transport	IDA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0015297	antiporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0061513	glucose 6-phosphate:inorganic phosphate antiporter activity	EXP	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0015152	glucose-6-phosphate transmembrane transporter activity	IMP	molecular function
GO:0015760	glucose-6-phosphate transport	IMP	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0015760	glucose-6-phosphate transport	NAS	biological process
GO:0006006	glucose metabolic process	NAS	biological process
GO:0005783	endoplasmic reticulum	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04973	Carbohydrate digestion and absorption

Diseases

Associated diseases	References
Glycogen storage disease	KEGG:H00069
Hepatic glycogen storage disease	KEGG:H01760
Glycogen storage disease type I	KEGG:H01939
Glycogen storage disease	KEGG:H00069
Hepatic glycogen storage disease	KEGG:H01760
Glycogen storage disease type I	KEGG:H01939
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881