• Gene id: 254170

Gene Summary

• Gene Symbol: FBXO33   Gene   UCSC   Ensembl
• Aliases: BMND12, Fbx33, c14_5247
• Gene name: F-box protein 33
• Alternate names: F-box only protein 33,
• Gene location: 14q21.1 (39432499: 39396372)     Exons: 4     NC_000014.9
• Gene summary(Entrez): This locus represents an member of the F-box gene family. The encoded protein contains an F-box motif and a domain that might form a structure similar to a leucine-rich repeat found in placental RNAse inhibitor. This locus may be associated with copy numb
• OMIM: 609103

Protein Summary

• Protein general information: Q7Z6M2  
  • Name: F box only protein 33
  • Length: 555  
  • Mass: 62630
• Sequence:

  MLLFLSVPQPRPPGARTRAGAARVARWRRLRLQQLRRLRGLLRVLRGRPGAGSRRRGRMALCGQAAGAASLPSEL
  IVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLRVSPAEQPRLEFLMRKCGWFVRELRVEFAAENYLS
  GGGPGDGGGADTGTGGEEVEALQLSARWLEVLRTYLELVLCVLVSIRNNRNLQKFSLFGDISVLQQQGSLSNTYL
  SKVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTLITAV
  ELERFVNLHSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVHNVSVMHKSLDNMPNDEHWKALSRKSTSFRVYIM
  AFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDKFLTHFILMNDVIDTSGFPDLSDNRNEDPLV
  LLAWRCTKLSLLAIHGYTVWAHNLIAIARLRGSDLKVLEVTEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPW
  HAVMDIESLSVFTEPNRHFYREMQSFSEDI

• Structural information:
  • Protein Domains: (65..11-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  IPR039940  IPR032675  
  • Prosite: PS50181
  • STRING: ENSP00000298097
• Other Databases: GeneCards:  FBXO33  Malacards:  FBXO33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019005	SCF ubiquitin ligase complex	IEA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)