• Gene id: 254122

Gene Summary

• Gene Symbol: SNX32   Gene   UCSC   Ensembl
• Aliases: SNX6B
• Gene name: sorting nexin 32
• Alternate names: sorting nexin-32, sorting nexin-6B,
• Gene location: 11q13.1 (135535963: 135534281)     Exons: 1     NC_000005.10

Protein Summary

• Protein general information: Q86XE0  
  • Name: Sorting nexin 32 (Sorting nexin 6B)
  • Length: 403  
  • Mass: 46399
• Sequence:

  METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYV
  ENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPT
  LRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDAC
  LRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS
  QAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLI
  ELAELELKHAKASTLILRNTLVALKGEP

• Structural information:
  • Protein Domains: (20..16-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147"-)
  • Interpro: IPR027267  IPR001683  IPR036871  IPR014637  IPR015404  
  • Prosite: PS50195
  • PDB: 6E8R
  • PDBsum: 6E8R
  • STRING: ENSP00000310620
• Other Databases: GeneCards:  SNX32  Malacards:  SNX32

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015031	protein transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0016241	regulation of macroautophagy	NAS	biological process
GO:0005768	endosome	IBA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0035091	phosphatidylinositol binding	IEA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq