• Gene id: 254013

Gene Summary

• Gene Symbol: ETFBKMT   Gene   UCSC   Ensembl
• Aliases: C12orf72, ETFB-KMT, METTL20
• Gene name: electron transfer flavoprotein subunit beta lysine methyltransferase
• Alternate names: electron transfer flavoprotein beta subunit lysine methyltransferase, ETFB lysine methyltransferase, methyltransferase like 20, methyltransferase-like protein 20, protein N-lysine methyltransferase METTL20,
• Gene location: 12p11.21 (31647159: 31673113)     Exons: 8     NC_000012.12

Protein Summary

• Protein general information: Q8IXQ9  
  • Name: Electron transfer flavoprotein beta subunit lysine methyltransferase (EC 2.1.1. ) (ETFB lysine methyltransferase) (ETFB KMT) (Protein N lysine methyltransferase METTL20)
  • Length: 262  
  • Mass: 29461
• Sequence:

  MALSLGWKAHRNHCGLLLQALRSSGLLLFPCGQCPWRGAGSFLDPEIKAFLEENTEVTSSGSLTPEIQLRLLTPR
  CKFWWERADLWPHSDPYWAIYWPGGQALSRYLLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASRILANDIDPIA
  GMAITLNCELNRLNPFPILIQNILNLEQDKWDLVVLGDMFYDEDLADSLHQWLKKCFWTYRTRVLIGDPGRPQFS
  GHSIQHHLHKVVEYSLLESTRQENSGLTTSTVWGFQP

• Structural information:
  • Interpro: IPR029063  
  • STRING: ENSP00000350353
• Other Databases: GeneCards:  ETFBKMT  Malacards:  ETFBKMT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0018023	peptidyl-lysine trimethylation	IMP	biological process
GO:0016279	protein-lysine N-methyltransferase activity	IMP	molecular function
GO:1904736	negative regulation of fatty acid beta-oxidation using acyl-CoA dehydrogenase	IMP	biological process
GO:0016279	protein-lysine N-methyltransferase activity	IMP	molecular function
GO:0018022	peptidyl-lysine methylation	IMP	biological process
GO:1904733	negative regulation of electron transfer activity	IMP	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006479	protein methylation	TAS	biological process
GO:0016279	protein-lysine N-methyltransferase activity	TAS	molecular function
GO:1904736	negative regulation of fatty acid beta-oxidation using acyl-CoA dehydrogenase	IEA	biological process
GO:0018023	peptidyl-lysine trimethylation	IEA	biological process
GO:0016279	protein-lysine N-methyltransferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0018023	peptidyl-lysine trimethylation	IMP	biological process
GO:0016279	protein-lysine N-methyltransferase activity	IMP	molecular function
GO:1904736	negative regulation of fatty acid beta-oxidation using acyl-CoA dehydrogenase	IMP	biological process
GO:0016279	protein-lysine N-methyltransferase activity	IMP	molecular function
GO:0018022	peptidyl-lysine methylation	IMP	biological process
GO:1904733	negative regulation of electron transfer activity	IMP	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006479	protein methylation	TAS	biological process
GO:0016279	protein-lysine N-methyltransferase activity	TAS	molecular function
GO:1904736	negative regulation of fatty acid beta-oxidation using acyl-CoA dehydrogenase	IEA	biological process
GO:0018023	peptidyl-lysine trimethylation	IEA	biological process
GO:0016279	protein-lysine N-methyltransferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881