• Gene id: 253943

Gene Summary

• Gene Symbol: YTHDF3   Gene   UCSC   Ensembl
• Gene name: YTH N6-methyladenosine RNA binding protein 3
• Alternate names: YTH domain-containing family protein 3, YTH N(6)-methyladenosine RNA binding protein 3, YTH domain family protein 3, YTH domain family, member 3,
• Gene location: 8q12.3 (63168552: 63212787)     Exons: 8     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the YTH (YT521-B homology) domain protein family. The YTH domain is common in eukaryotes, is often found in the middle of the protein sequence, and may function in binding to RNA. Alternative splicing results in multiple tran
• OMIM: 618669

Protein Summary

• Protein general information: Q7Z739  
  • Name: YTH domain containing family protein 3
  • Length: 585  
  • Mass: 63861
• Sequence:

  MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSYYAPSIGFPYSLGEAA
  WSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSA
  YSSSYGYPPSSLGRAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNSV
  PPVSSAAPKPTSWAAIARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPPQTI
  IQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQPQQQQLQNRWVAPRNRGAGFNQNNGAGSENF
  GLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDA
  AYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENND
  NKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEEEAMRRERNRNKQ

• Structural information:
  • Protein Domains: (416..55-)
    (/note="YTH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00225"-)
  • Interpro: IPR007275  
  • Prosite: PS50882
  • STRING: ENSP00000478490
• Other Databases: GeneCards:  YTHDF3  Malacards:  YTHDF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061157	mRNA destabilization	IBA	biological process
GO:0045948	positive regulation of translational initiation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:1990247	N6-methyladenosine-containing RNA binding	IBA	molecular function
GO:0003729	mRNA binding	IBA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0043022	ribosome binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0045948	positive regulation of translational initiation	IDA	biological process
GO:0045727	positive regulation of translation	IMP	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061157	mRNA destabilization	IMP	biological process
GO:0060339	negative regulation of type I interferon-mediated signaling pathway	ISS	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq