• Gene id: 2537

Gene Summary

• Gene Symbol: IFI6   Gene   UCSC   Ensembl
• Aliases: 6-16, FAM14C, G1P3, IFI-6-16, IFI616
• Gene name: interferon alpha inducible protein 6
• Alternate names: interferon alpha-inducible protein 6, interferon, alpha-inducible protein clone IFI-6-16, interferon-induced protein 6-16,
• Gene location: 1p35.3 (51927146: 51946620)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mam
• OMIM: 147572

Protein Summary

• Protein general information: P09912  
  • Name: Interferon alpha inducible protein 6 (Interferon induced protein 6 16) (Ifi 6 16)
  • Length: 130  
  • Mass: 12927
• Sequence:

  MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASL
  MSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE

• Structural information:
  • Interpro: IPR009311  IPR038213  
  • STRING: ENSP00000342513
• Other Databases: GeneCards:  IFI6  Malacards:  IFI6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0001836	release of cytochrome c from mitochondria	IMP	biological process
GO:0051902	negative regulation of mitochondrial depolarization	IMP	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:0051902	negative regulation of mitochondrial depolarization	IBA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0097190	apoptotic signaling pathway	IBA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0097193	intrinsic apoptotic signaling pathway	IMP	biological process
GO:0051607	defense response to virus	IMP	biological process
GO:0045087	innate immune response	IMP	biological process
GO:0042058	regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0098586	cellular response to virus	IMP	biological process
GO:0072593	reactive oxygen species metabolic process	IMP	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051607	defense response to virus	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IMP	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)