• Gene id: 253559

Gene Summary

• Gene Symbol: CADM2   Gene   UCSC   Ensembl
• Aliases: IGSF4D, NECL3, Necl-3, SynCAM 2, synCAM2
• Gene name: cell adhesion molecule 2
• Alternate names: cell adhesion molecule 2, immunoglobulin superfamily member 4D, nectin-like 3, nectin-like protein 3, synaptic cell adhesion molecule 2,
• Gene location: 3p12.1 (84958988: 86074428)     Exons: 14     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the synaptic cell adhesion molecule 1 (SynCAM) family which belongs to the immunoglobulin (Ig) superfamily. The encoded protein has three Ig-like domains and a cytosolic protein 4.1 binding site near the C-terminus. Proteins

Protein Summary

• Protein general information: Q8N3J6  
  • Name: Cell adhesion molecule 2 (Immunoglobulin superfamily member 4D) (IgSF4D) (Nectin like protein 3) (NECL 3) (Synaptic cell adhesion molecule 2) (SynCAM 2)
  • Length: 435  
  • Mass: 47554
• Sequence:

  MIWKRSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDN
  RIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSG
  SKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHY
  TPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATN
  TIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALAGQNGPDHALIGGIVA
  VVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINAEGSQVNAEEKKEYFI

• Structural information:
  • Protein Domains: (27..11-)
    (/note="Ig-like-V-type)
    (127..21-)
    1 (/note="Ig-like-C2-type)
    (227..31-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR013162  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  IPR013106  IPR003585  
  • Prosite: PS50835
  • STRING: ENSP00000384193
• Other Databases: GeneCards:  CADM2  Malacards:  CADM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component

Diseases

Associated diseases	References
Autism spectrum disorder	PMID:21996756
Astrocytoma	PMID:30816549
hepatocellular carcinoma	PMID:24240726
retinoblastoma	PMID:30320366
Psoriasis	PMID:21864505
type 2 diabetes mellitus	PMID:28401323
obesity	PMID:31341224
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray