• Gene id: 2535

Gene Summary

• Gene Symbol: FZD2   Gene   UCSC   Ensembl
• Aliases: Fz2, OMOD2, fz-2, fzE2, hFz2
• Gene name: frizzled class receptor 2
• Alternate names: frizzled-2, frizzled 2, seven transmembrane spanning receptor, frizzled family receptor 2, frizzled homolog 2,
• Gene location: 17q21.31 (44557483: 44561261)     Exons: 1     NC_000017.11
• Gene summary(Entrez): This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. This gene encodes a protein that i
• OMIM: 600667

Protein Summary

• Protein general information: Q14332  
  • Name: Frizzled 2 (Fz 2) (hFz2) (FzE2)
  • Length: 565  
  • Mass: 63554
  • Tissue specificity: Widely expressed. In the adult, mainly found in heart, placenta, skeletal muscle, lung, kidney, pancreas, prostate, testis, ovary and colon. In the fetus, expressed in brain, lung and kidney. Low levels in fetal liver.
• Sequence:

  MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQ
  FYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQIC
  VGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPC
  EPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
  QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLA
  AWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGT
  KTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKY
  LMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGETTV

• Structural information:
  • Protein Domains: (34..15-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090"-)
  • Interpro: IPR015526  IPR000539  IPR020067  IPR036790  IPR041778   IPR026550  IPR017981  
  • Prosite: PS50038 PS50261
  • CDD: cd07464
  • PDB: 6C0B
  • PDBsum: 6C0B
  • STRING: ENSP00000323901
• Other Databases: GeneCards:  FZD2  Malacards:  FZD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042813	Wnt-activated receptor activity	NAS	molecular function
GO:0017147	Wnt-protein binding	NAS	molecular function
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	NAS	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0042813	Wnt-activated receptor activity	IBA	molecular function
GO:0016055	Wnt signaling pathway	IMP	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042813	Wnt-activated receptor activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0003149	membranous septum morphogenesis	IEA	biological process
GO:0003150	muscular septum morphogenesis	IEA	biological process
GO:0003151	outflow tract morphogenesis	IEA	biological process
GO:0007608	sensory perception of smell	IEA	biological process
GO:0030855	epithelial cell differentiation	IEA	biological process
GO:0060022	hard palate development	IEA	biological process
GO:0060119	inner ear receptor cell development	IEA	biological process
GO:0060412	ventricular septum morphogenesis	IEA	biological process
GO:0090103	cochlea morphogenesis	IEA	biological process
GO:0090179	planar cell polarity pathway involved in neural tube closure	IEA	biological process
GO:0007267	cell-cell signaling	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Omodysplasia	KEGG:H02154
Omodysplasia	KEGG:H02154
leiomyoma	PMID:12909487
Breast carcinoma	PMID:15492823
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881