• Gene id: 253430

Gene Summary

• Gene Symbol: IPMK   Gene   UCSC   Ensembl
• Gene name: inositol polyphosphate multikinase
• Alternate names: inositol polyphosphate multikinase, inositol 1,3,4,6-tetrakisphosphate 5-kinase,
• Gene location: 10q21.1 (58269960: 58191516)     Exons: 7     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the inositol phosphokinase family. The encoded protein has 3-kinase, 5-kinase and 6-kinase activities on phosphorylated inositol substrates. The encoded protein plays an important role in the biosynthesis of inositol 1,3,4,5,
• OMIM: 609938

Protein Summary

• Protein general information: Q8NFU5  
  • Name: Inositol polyphosphate multikinase (EC 2.7.1.140) (EC 2.7.1.151) (EC 2.7.1.153) (Inositol 1,3,4,6 tetrakisphosphate 5 kinase)
  • Length: 416  
  • Mass: 47222
  • Tissue specificity: Ubiquitous, with the highest expression in skeletal muscle, liver, placenta, lung, peripheral blood leukocytes, kidney, spleen and colon. {ECO
• Sequence:

  MATEPPSPLRVEAPGPPEMRTSPAIESTPEGTPQPAGGRLRFLNGCVPLSHQVAGHMYGKDKVGILQHPDGTVLK
  QLQPPPRGPRELEFYNMVYAADCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKPCIMDVKIGQK
  SYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDA
  VAASIQKIEKILQWFENQKQLNFYASSLLFVYEGSSQPTTTKLNDRTLAEKFLSKGQLSDTEVLEYNNNFHVLSS
  TANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMSQEHLNGNVLSQLEKVFYHLPTGCQE
  IAEVEVRMIDFAHVFPSNTIDEGYVYGLKHLISVLRSILDN

• Structural information:
  • Interpro: IPR005522  IPR038286  
  • PDB: 5W2G 5W2H 5W2I 6E7F 6M88 6M89 6M8A 6M8B 6M8C 6M8D 6M8E
  • PDBsum: 5W2G 5W2H 5W2I 6E7F 6M88 6M89 6M8A 6M8B 6M8C 6M8D 6M8E
  • STRING: ENSP00000363046
• Other Databases: GeneCards:  IPMK  Malacards:  IPMK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016301	kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	IBA	molecular function
GO:0032958	inositol phosphate biosynthetic process	IBA	biological process
GO:0051765	inositol tetrakisphosphate kinase activity	IBA	molecular function
GO:0097243	flavonoid binding	IDA	molecular function
GO:0032957	inositol trisphosphate metabolic process	IDA	biological process
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	IDA	molecular function
GO:0000825	inositol tetrakisphosphate 6-kinase activity	IMP	molecular function
GO:0070266	necroptotic process	IMP	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0032958	inositol phosphate biosynthetic process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0102732	myo-inositol-1,2,3,4,6-heptakisphosphate 5-kinase activity	IEA	molecular function
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	IEA	molecular function
GO:0052812	phosphatidylinositol-3,4-bisphosphate 5-kinase activity	IEA	molecular function
GO:0000823	inositol-1,4,5-trisphosphate 6-kinase activity	IEA	molecular function
GO:0047326	inositol tetrakisphosphate 5-kinase activity	IEA	molecular function
GO:0000824	inositol tetrakisphosphate 3-kinase activity	TAS	molecular function
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	TAS	molecular function
GO:0047326	inositol tetrakisphosphate 5-kinase activity	TAS	molecular function
GO:0000825	inositol tetrakisphosphate 6-kinase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0046488	phosphatidylinositol metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq