• Gene id: 2533

Gene Summary

• Gene Symbol: FYB1   Gene   UCSC   Ensembl
• Aliases: ADAP, FYB, PRO0823, SLAP-130, SLAP130, THC3
• Gene name: FYN binding protein 1
• Alternate names: FYN-binding protein 1, FYB-120/130, FYN-T-binding protein, FYN-binding protein, SLP-76-associated phosphoprotein, adhesion and degranulation-promoting adaptor protein, p120/p130,
• Gene location: 5p13.1 (39274499: 39105251)     Exons: 26     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is an adapter for the FYN protein and LCP2 signaling cascades in T-cells. The encoded protein is involved in platelet activation and controls the expression of interleukin-2. Three transcript variants encoding different is
• OMIM: 607560

Protein Summary

• Protein general information: O15117  
  • Name: FYN binding protein 1 (Adhesion and degranulation promoting adaptor protein) (ADAP) (FYB 120/130) (p120/p130) (FYN T binding protein) (SLAP 130) (SLP 76 associated phosphoprotein)
  • Length: 783  
  • Mass: 85387
  • Tissue specificity: Expressed in hematopoietic tissues such as myeloid and T-cells, spleen and thymus. Not expressed in B-cells, nor in non-lymphoid tissues.
• Sequence:

  MAKYNTGGNPTEDVSVNSRPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSSEEKPD
  KEPKPPFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINLPKEDSKPTFPWPPGNKPSLHSVNQDHDLKP
  LGPKSGPTPPTSENEQKQAFPKLTGVKGKFMSASQDLEPKPLFPKPAFGQKPPLSTENSHEDESPMKNVSSSKGS
  PAPLGVRSKSGPLKPAREDSENKDHAGEISSLPFPGVVLKPAASRGGPGLSKNGEEKKEDRKIDAAKNTFQSKIN
  QEELASGTPPARFPKAPSKLTVGGPWGQSQEKEKGDKNSATPKQKPLPPLFTLGPPPPKPNRPPNVDLTKFHKTS
  SGNSTSKGQTSYSTTSLPPPPPSHPASQPPLPASHPSQPPVPSLPPRNIKPPFDLKSPVNEDNQDGVTHSDGAGN
  LDEEQDSEGETYEDIEASKEREKKREKEEKKRLELEKKEQKEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGG
  KNELSFKQGEQIEIIRITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLKLKKDSLGAPSRPIEDDQEVYDDVAE
  QDDISSHSQSGSGGIFPPPPDDDIYDGIEEEDADDGFPAPPKQLDMGDEVYDDVDTSDFPVSSAEMSQGTNVGKA
  KTEEKDLKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRN
  EEGKYGYVLRSYLADNDGEIYDDIADGCIYDND

• Structural information:
  • Protein Domains: (511..57-)
    (/note="SH3-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (700..76-)
    (/note="SH3-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR030635  IPR035540  IPR029294  IPR036028  IPR001452  
  • Prosite: PS50002
  • CDD: cd11867
  • PDB: 1RI9 2GTJ 2GTO
  • PDBsum: 1RI9 2GTJ 2GTO
  • DIP: 42204
  • STRING: ENSP00000427114
• Other Databases: GeneCards:  FYB1  Malacards:  FYB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0015629	actin cytoskeleton	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04015	Rap1 signaling pathway
hsa05135	Yersinia infection

Diseases

Associated diseases	References
Thrombocytopenia	KEGG:H00978
Thrombocytopenia	KEGG:H00978
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881