• Gene id: 2532

Gene Summary

• Gene Symbol: ACKR1   Gene   UCSC   Ensembl
• Aliases: CCBP1, CD234, DARC, DARC/ACKR1, Dfy, FY, GPD, GpFy, WBCQ1
• Gene name: atypical chemokine receptor 1 (Duffy blood group)
• Alternate names: atypical chemokine receptor 1, Duffy antigen chemokine receptor, Duffy blood group antigen, Duffy blood group system protein, Duffy blood group, chemokine receptor, Fy glycoprotein, glycoprotein D, plasmodium vivax receptor,
• Gene location: 1q23.2 (159204874: 159206499)     Exons: 2     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this ge
• OMIM: 300392

Protein Summary

• Protein general information: Q16570  
  • Name: Atypical chemokine receptor 1 (Duffy antigen/chemokine receptor) (Fy glycoprotein) (GpFy) (Glycoprotein D) (Plasmodium vivax receptor) (CD antigen CD234)
  • Length: 336  
  • Mass: 35553
  • Tissue specificity: Found in adult kidney, adult spleen, bone marrow and fetal liver. In particular, it is expressed along postcapillary venules throughout the body, except in the adult liver. Erythroid cells and postcapillary venule endothelium are the p
• Sequence:

  MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILA
  SSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCH
  ASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGL
  FGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT
  PLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

• Structural information:
  • Interpro: IPR005384  
  • PDB: 4NUU 4NUV
  • PDBsum: 4NUU 4NUV
  • DIP: 3783
  • STRING: ENSP00000357103
• Other Databases: GeneCards:  ACKR1  Malacards:  ACKR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032642	regulation of chemokine production	IBA	biological process
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0006954	inflammatory response	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019956	chemokine binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0055037	recycling endosome	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006952	defense response	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05144	Malaria

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881