• Gene id: 253017

Gene Summary

• Gene Symbol: TECRL   Gene   UCSC   Ensembl
• Aliases: CPVT3, GPSN2L, SRD5A2L2, TERL
• Gene name: trans-2,3-enoyl-CoA reductase like
• Alternate names: trans-2,3-enoyl-CoA reductase-like, glycoprotein, synaptic 2-like, steroid 5 alpha-reductase 2-like 2, steroid 5-alpha-reductase 2-like 2 protein,
• Gene location: 4q13.1 (64409509: 64276297)     Exons: 37     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene contains a ubiquitin-like domain in the N-terminal region, three transmembrane segments and a C-terminal 3-oxo-5-alpha steroid 4-dehydrogenase domain. The protein belongs to the steroid 5-alpha reductase family. Mutations
• OMIM: 617242

Protein Summary

• Protein general information: Q5HYJ1  
  • Name: Trans 2,3 enoyl CoA reductase like (EC 1.3.1. ) (Steroid 5 alpha reductase 2 like 2 protein)
  • Length: 363  
  • Mass: 42009
  • Tissue specificity: Predominantly expressed in the heart and skeletal muscle. {ECO
• Sequence:

  MFKRHKSLASERKRALLSQRATRFILKDDMRNFHFLSKLVLSAGPLRPTPAVKHSKTTHFEIEIFDAQTRKQICI
  LDKVTQSSTIHDVKQKFHKACPKWYPSRVGLQLECGGPFLKDYITIQSIAASSIVTLYATDLGQQVSWTTVFLAE
  YTGPLLIYLLFYLRIPCIYDGKESARRLRHPVVHLACFCHCIHYIRYLLETLFVHKVSAGHTPLKNLIMSCAFYW
  GFTSWIAYYINHPLYTPPSFGNRQITVSAINFLICEAGNHFINVMLSHPNHTGNNACFPSPNYNPFTWMFFLVSC
  PNYTYEIGSWISFTVMTQTLPVGIFTLLMSIQMSLWAQKKHKIYLRKFNSYIHRKSAMIPFIL

• Structural information:
  • Interpro: IPR001104  IPR039357  
  • Prosite: PS50244
  • STRING: ENSP00000370607
• Other Databases: GeneCards:  TECRL  Malacards:  TECRL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016491	oxidoreductase activity	IBA	molecular function
GO:0042761	very long-chain fatty acid biosynthetic process	IBA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Catecholaminergic polymorphic ventricular tachycardia	KEGG:H01019
Catecholaminergic polymorphic ventricular tachycardia	KEGG:H01019
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)