• Gene id: 2530

Gene Summary

• Gene Symbol: FUT8   Gene   UCSC   Ensembl
• Aliases: CDGF, CDGF1
• Gene name: fucosyltransferase 8
• Alternate names: alpha-(1,6)-fucosyltransferase, GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase, GDP-fucose--glycoprotein fucosyltransferase, alpha1-6FucT, fucosyltransferase 8 (alpha (1,6) fucosyltransferase), glycoprotein 6-alpha-L-fucosyltransferase,
• Gene location: 14q23.3 (65410591: 65744121)     Exons: 3     NC_000014.9
• Gene summary(Entrez): This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which cata
• OMIM: 602589

Protein Summary

• Protein general information: Q9BYC5  
  • Name: Alpha (1,6) fucosyltransferase (Alpha1 6FucT) (EC 2.4.1.68) (Fucosyltransferase 8) (GDP L Fuc:N acetyl beta D glucosaminide alpha1,6 fucosyltransferase) (GDP fucose glycoprotein fucosyltransferase) (Glycoprotein 6 alpha L fucosyltransferase)
  • Length: 575  
  • Mass: 66516
• Sequence:

  MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLRIPEGPID
  QGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKNLEGNELQRHAD
  EFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLH
  HVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGEVKDKNVQVVELPIVDSLHPR
  PPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAA
  FHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGV
  ILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEP
  GDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK

• Structural information:
  • Protein Domains: (206..49-)
    (/note="GT23-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00992-)
    (502..56-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR015827  IPR035653  IPR027350  IPR036028  IPR001452  
  • Prosite: PS51659 PS50002
  • CDD: cd11792
  • PDB: 2DE0
  • PDBsum: 2DE0
  • STRING: ENSP00000353910
• Other Databases: GeneCards:  FUT8  Malacards:  FUT8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046921	alpha-(1->6)-fucosyltransferase activity	IBA	molecular function
GO:0006487	protein N-linked glycosylation	IBA	biological process
GO:0036071	N-glycan fucosylation	IBA	biological process
GO:0046368	GDP-L-fucose metabolic process	IDA	biological process
GO:0018279	protein N-linked glycosylation via asparagine	IDA	biological process
GO:0008424	glycoprotein 6-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0008424	glycoprotein 6-alpha-L-fucosyltransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0033578	protein glycosylation in Golgi	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008424	glycoprotein 6-alpha-L-fucosyltransferase activity	TAS	molecular function
GO:0006487	protein N-linked glycosylation	TAS	biological process
GO:0009312	oligosaccharide biosynthetic process	TAS	biological process
GO:0008424	glycoprotein 6-alpha-L-fucosyltransferase activity	IEA	molecular function
GO:0008424	glycoprotein 6-alpha-L-fucosyltransferase activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046921	alpha-(1->6)-fucosyltransferase activity	IEA	molecular function
GO:0016477	cell migration	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0006491	N-glycan processing	IEA	biological process
GO:1900407	regulation of cellular response to oxidative stress	IEA	biological process
GO:0043112	receptor metabolic process	IEA	biological process
GO:0036071	N-glycan fucosylation	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0007585	respiratory gaseous exchange by respiratory system	IEA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042355	L-fucose catabolic process	NAS	biological process
GO:0005794	Golgi apparatus	NAS	cellular component
GO:0008424	glycoprotein 6-alpha-L-fucosyltransferase activity	TAS	molecular function
GO:0001701	in utero embryonic development	NAS	biological process
GO:0006491	N-glycan processing	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05202	Transcriptional misregulation in cancer
hsa00510	N-Glycan biosynthesis
hsa00513	Various types of N-glycan biosynthesis
hsa00533	Glycosaminoglycan biosynthesis - keratan sulfate

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq