• Gene id: 252995

Gene Summary

• Gene Symbol: FNDC5   Gene   UCSC   Ensembl
• Aliases: FRCP2, irisin
• Gene name: fibronectin type III domain containing 5
• Alternate names: fibronectin type III domain-containing protein 5, fibronectin type III repeat-containing protein 2,
• Gene location: 1p35.1 (32872483: 32862267)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is con
• OMIM: 611906

Protein Summary

• Protein general information: Q8NAU1  
  • Name: Fibronectin type III domain containing protein 5 (Fibronectin type III repeat containing protein 2) [Cleaved into: Irisin]
  • Length: 212  
  • Mass: 23659
  • Tissue specificity: Widely expressed, with highest levels in heart. Very low expression, if any, in colon, pancreas and spleen. {ECO
• Sequence:

  MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVR
  MLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQL
  RTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI

• Structural information:
  • Protein Domains: (36..12-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR032073  IPR013783  
  • Prosite: PS50853
  • CDD: cd00063
  • PDB: 4LSD
  • PDBsum: 4LSD
  • STRING: ENSP00000362570
• Other Databases: GeneCards:  FNDC5  Malacards:  FNDC5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0090336	positive regulation of brown fat cell differentiation	IBA	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0008150	biological_process	ND	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0090336	positive regulation of brown fat cell differentiation	ISS	biological process
GO:0014850	response to muscle activity	ISS	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005576	extracellular region	ISS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)