• Gene id: 252969

Gene Summary

• Gene Symbol: NEIL2   Gene   UCSC   Ensembl
• Aliases: NEH2, NEI2
• Gene name: nei like DNA glycosylase 2
• Alternate names: endonuclease 8-like 2, DNA glycosylase/AP lyase Neil2, DNA-(apurinic or apyrimidinic site) lyase Neil2, nei endonuclease VIII-like 2, nei homolog 2, nei-like protein 2,
• Gene location: 8p23.1 (47352701: 47331405)     Exons: 35     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the Fpg/Nei family of DNA glycosylases. These glycosylases initiate the first step in base excision repair by cleaving oxidatively damaged bases and introducing a DNA strand break via their abasic site lyase activity. This en
• OMIM: 608933

Protein Summary

• Protein general information: Q969S2  
  • Name: Endonuclease 8 like 2 (EC 3.2.2. ) (EC 4.2.99.18) (DNA glycosylase/AP lyase Neil2) (DNA (apurinic or apyrimidinic site) lyase Neil2) (Endonuclease VIII like 2) (Nei homolog 2) (NEH2) (Nei like protein 2)
  • Length: 332  
  • Mass: 36826
  • Tissue specificity: Detected in testis, skeletal muscle, heart, brain, placenta, lung, pancreas, kidney and liver. {ECO
• Sequence:

  MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQ
  KEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAK
  KANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRY
  FSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKE
  AFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS

• Structural information:
  • Interpro: IPR015886  IPR012319  IPR010979  IPR000214  
  • Prosite: PS51068 PS51066
  • PDB: 1VZP
  • PDBsum: 1VZP
  • STRING: ENSP00000284503
• Other Databases: GeneCards:  NEIL2  Malacards:  NEIL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006284	base-excision repair	IBA	biological process
GO:0019104	DNA N-glycosylase activity	IBA	molecular function
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity	IBA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006284	base-excision repair	IEA	biological process
GO:0006289	nucleotide-excision repair	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016799	hydrolase activity, hydrolyzing N-glycosyl compounds	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0140078	class I DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA	molecular function
GO:0045008	depyrimidination	TAS	biological process
GO:0045008	depyrimidination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0005876	spindle microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03410	Base excision repair

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881