• Gene id: 2529

Gene Summary

• Gene Symbol: FUT7   Gene   UCSC   Ensembl
• Aliases: FucT-VII
• Gene name: fucosyltransferase 7
• Alternate names: alpha-(1,3)-fucosyltransferase 7, fuc-TVII, fucosyltransferase 7 (alpha (1,3) fucosyltransferase), fucosyltransferase VII, galactoside 3-L-fucosyltransferase, selectin-ligand synthase,
• Gene location: 9q34.3 (137032087: 137030173)     Exons: 2     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq, Jul 2008]
• OMIM: 104219

Protein Summary

• Protein general information: Q11130  
  • Name: Alpha (1,3) fucosyltransferase 7 (EC 2.4.1. ) (Fucosyltransferase 7) (Fucosyltransferase VII) (Fuc TVII) (FucT VII) (Galactoside 3 L fucosyltransferase) (Selectin ligand synthase)
  • Length: 342  
  • Mass: 39239
  • Tissue specificity: Leukocytic/myeloid lineage cells.
• Sequence:

  MNNAGHGPTRRLRGLGVLAGVALLAALWLLWLLGSAPRGTPAPQPTITILVWHWPFTDQPPELPSDTCTRYGIAR
  CHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWASMESPSHTHGLSHLRGIFNWVLSYRRDSDIF
  VPYGRLEPHWGPSPPLPAKSRVAAWVVSNFQERQLRARLYRQLAPHLRVDVFGRANGRPLCASCLVPTVAQYRFY
  LSFENSQHRDYITEKFWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFA
  WRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA

• Structural information:
  • Interpro: IPR031481  IPR001503  IPR038577  
  • STRING: ENSP00000318142
• Other Databases: GeneCards:  FUT7  Malacards:  FUT7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IBA	molecular function
GO:0036065	fucosylation	IBA	biological process
GO:0006486	protein glycosylation	IDA	biological process
GO:0008417	fucosyltransferase activity	IDA	molecular function
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IDA	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IDA	molecular function
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IDA	molecular function
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IDA	molecular function
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IDA	molecular function
GO:0002523	leukocyte migration involved in inflammatory response	ISS	biological process
GO:0001807	regulation of type IV hypersensitivity	ISS	biological process
GO:1903238	positive regulation of leukocyte tethering or rolling	ISS	biological process
GO:0046626	regulation of insulin receptor signaling pathway	IMP	biological process
GO:1904996	positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	biological process
GO:0022407	regulation of cell-cell adhesion	IMP	biological process
GO:1903037	regulation of leukocyte cell-cell adhesion	IMP	biological process
GO:0007566	embryo implantation	IMP	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0060353	regulation of cell adhesion molecule production	IMP	biological process
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IMP	molecular function
GO:0045785	positive regulation of cell adhesion	IMP	biological process
GO:1903236	regulation of leukocyte tethering or rolling	IMP	biological process
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IMP	molecular function
GO:0022409	positive regulation of cell-cell adhesion	IMP	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0008417	fucosyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001807	regulation of type IV hypersensitivity	IEA	biological process
GO:0002522	leukocyte migration involved in immune response	IEA	biological process
GO:0002523	leukocyte migration involved in inflammatory response	IEA	biological process
GO:0097021	lymphocyte migration into lymphoid organs	IEA	biological process
GO:1903238	positive regulation of leukocyte tethering or rolling	IEA	biological process
GO:1904994	regulation of leukocyte adhesion to vascular endothelial cell	IEA	biological process
GO:2000389	regulation of neutrophil extravasation	IEA	biological process
GO:0002361	CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IEA	molecular function
GO:0008417	fucosyltransferase activity	IDA	molecular function
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0042355	L-fucose catabolic process	NAS	biological process
GO:0006486	protein glycosylation	TAS	biological process
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0046920	alpha-(1->3)-fucosyltransferase activity	TAS	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00601	Glycosphingolipid biosynthesis - lacto and neolacto series

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq