• Gene id: 252884

Gene Summary

• Gene Symbol: ZNF396   Gene   UCSC   Ensembl
• Aliases: ZSCAN14
• Gene name: zinc finger protein 396
• Alternate names: zinc finger protein 396, zinc finger and SCAN domain-containing protein 14,
• Gene location: 18q12.2 (35377336: 35366693)     Exons: 6     NC_000018.10
• OMIM: 142711

Protein Summary

• Protein general information: Q96N95  
  • Name: Zinc finger protein 396 (Zinc finger and SCAN domain containing protein 14)
  • Length: 335  
  • Mass: 38612
  • Tissue specificity: Expressed strongly in liver, moderately in skeletal muscle and weakly in kidney, pancreas, spleen and prostate. {ECO
• Sequence:

  MSAKLGKSSSLLTQTSEECNGILTEKMEEEEQTCDPDSSLHWSSSYSPETFRQQFRQFGYQDSPGPHEALSRLWE
  LCHLWLRPEVHTKEQILELLVLEQFLAILPKELQAWVQKHHPENGEETVTMLEDVERELDGPKQIFFGRRKDMIA
  EKLAPSEITEELPSSQLMPVKKQLQGASWELQSLRPHDEDIKTTNVKSASRQKTSLGIELHCNVSNILHMNGSQS
  STYRGTYEQDGRFEKRQGNPSWKKQQKCDECGKIFSQSSALILHQRIHSGKKPYACDECAKAFSRSAILIQHRRT
  HTGEKPYKCHDCGKAFSQSSNLFRHRKRHIRKKVP

• Structural information:
  • Protein Domains: (52..13-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187"-)
  • Interpro: IPR003309  IPR038269  IPR036236  IPR013087  
  • Prosite: PS50804 PS00028 PS50157
  • CDD: cd07936
  • STRING: ENSP00000302310
• Other Databases: GeneCards:  ZNF396  Malacards:  ZNF396

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881