• Gene id: 252839

Gene Summary

• Gene Symbol: TMEM9   Gene   UCSC   Ensembl
• Aliases: DERM4, TMEM9A
• Gene name: transmembrane protein 9
• Alternate names: transmembrane protein 9, dermal papilla-derived protein 4,
• Gene location: 1q32.1 (201171624: 201134770)     Exons: 7     NC_000001.11

Protein Summary

• Protein general information: Q9P0T7  
  • Name: Transmembrane protein 9 (Dermal papilla derived protein 4)
  • Length: 183  
  • Mass: 20574
  • Tissue specificity: Highly expressed in adrenal gland, thyroid gland, testis, ovary and prostate. Moderate expression in trachea, spinal cord, stomach, colon, small intestine and spleen. Low expression in bone marrow, lymph node, thymus and peripheral blo
• Sequence:

  MKLLSLVAVVGCLLVPPAEANKSSEDIRCKCICPPYRNISGHIYNQNVSQKDCNCLHVVEPMPVPGHDVEAYCLL
  CECRYEERSTTTIKVIIVIYLSVVGALLLYMAFLMLVDPLIRKPDAYTEQLHNEEENEDARSMAAAAASLGGPRA
  NTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS

• Structural information:
  • Interpro: IPR008853  
  • STRING: ENSP00000356301
• Other Databases: GeneCards:  TMEM9  Malacards:  TMEM9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq