• Gene id: 2528

Gene Summary

• Gene Symbol: FUT6   Gene   UCSC   Ensembl
• Aliases: FCT3A, FT1A, Fuc-TVI, FucT-VI
• Gene name: fucosyltransferase 6
• Alternate names: alpha-(1,3)-fucosyltransferase 6, fucosyltransferase 6 (alpha (1,3) fucosyltransferase), fucosyltransferase VI, galactoside 3-L-fucosyltransferase,
• Gene location: 19p13.3 (5840018: 5830407)     Exons: 5     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same p
• OMIM: 136836

Protein Summary

• Protein general information: P51993  
  • Name: Alpha (1,3) fucosyltransferase 6 (EC 2.4.1.65) (Fucosyltransferase 6) (Fucosyltransferase VI) (Fuc TVI) (FucT VI) (Galactoside 3 L fucosyltransferase)
  • Length: 359  
  • Mass: 41860
  • Tissue specificity: Kidney, liver, colon, small intestine, bladder, uterus and salivary gland.
• Sequence:

  MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPI
  ALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDG
  YFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSH
  KPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKD
  LARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT

• Structural information:
  • Interpro: IPR031481  IPR001503  IPR038577  
  • STRING: ENSP00000313398
• Other Databases: GeneCards:  FUT6  Malacards:  FUT6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036065	fucosylation	IBA	biological process
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IBA	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0036071	N-glycan fucosylation	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008417	fucosyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008417	fucosyltransferase activity	TAS	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IEA	molecular function
GO:0008417	fucosyltransferase activity	IDA	molecular function
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0046920	alpha-(1->3)-fucosyltransferase activity	TAS	molecular function
GO:0042355	L-fucose catabolic process	NAS	biological process
GO:0006486	protein glycosylation	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00601	Glycosphingolipid biosynthesis - lacto and neolacto series

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)