• Gene id: 2526

Gene Summary

• Gene Symbol: FUT4   Gene   UCSC   Ensembl
• Aliases: CD15, ELFT, FCT3A, FUC-TIV, FUTIV, LeX, SSEA-1
• Gene name: fucosyltransferase 4
• Alternate names: alpha-(1,3)-fucosyltransferase 4, ELAM ligand fucosyltransferase, ELAM-1 ligand fucosyltransferase, Lewis X, alpha (1,3) fucosyltransferase, myeloid-specific, fucT-IV, fucosyltransferase IV, galactoside 3-L-fucosyltransferase, stage-specific embryonic ant,
• Gene location: 11q21 (55737993: 55817145)     Exons: 24     NC_000005.10
• Gene summary(Entrez): The product of this gene transfers fucose to N-acetyllactosamine polysaccharides to generate fucosylated carbohydrate structures. It catalyzes the synthesis of the non-sialylated antigen, Lewis x (CD15). [provided by RefSeq, Jan 2009]
• OMIM: 104230

Protein Summary

• Protein general information: P22083  
  • Name: Alpha (1,3) fucosyltransferase 4 (EC 2.4.1. ) (ELAM 1 ligand fucosyltransferase) (Fucosyltransferase 4) (Fucosyltransferase IV) (Fuc TIV) (FucT IV) (Galactoside 3 L fucosyltransferase)
  • Length: 530  
  • Mass: 59,084
• Sequence:

  MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALAARPARHLGGAGQGPR
  PLHSGTAPFHSRASGERQRRLEPQLQHESRCRSSTPADAWRAEAALPVRAMGAPWGSPTAAAGGRRGWRRGRGLP
  WTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTD
  RASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESP
  SHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYH
  QLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVLGPDRANYERF
  VPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLA
  SWFER

• Structural information:
  • Interpro: IPR031481  IPR001503  IPR038577  
  • STRING: ENSP00000351602
• Other Databases: GeneCards:  FUT4  Malacards:  FUT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0006486	protein glycosylation	TAS	biological process
GO:0008417	fucosyltransferase activity	TAS	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0036065	fucosylation	IEA	biological process
GO:0042355	L-fucose catabolic process	NAS	biological process
GO:0046920	alpha-(1->3)-fucosyltransferase activity	TAS	molecular function
GO:0071944	cell periphery	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0006486	protein glycosylation	TAS	biological process
GO:0008417	fucosyltransferase activity	IEA	molecular function
GO:0008417	fucosyltransferase activity	TAS	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0036065	fucosylation	IEA	biological process
GO:0042355	L-fucose catabolic process	NAS	biological process
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IEA	molecular function
GO:0046920	alpha-(1->3)-fucosyltransferase activity	TAS	molecular function
GO:0071944	cell periphery	IEA	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0006486	protein glycosylation	TAS	biological process
GO:0008417	fucosyltransferase activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0042355	L-fucose catabolic process	NAS	biological process
GO:0046920	alpha-(1->3)-fucosyltransferase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways

Diseases

Associated diseases	References
Azoospermia	MIK: 20508065
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 20508065
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20508065	Azoospermia				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray