• Gene id: 2525

Gene Summary

• Gene Symbol: FUT3   Gene   UCSC   Ensembl
• Aliases: CD174, FT3B, FucT-III, LE, Les
• Gene name: fucosyltransferase 3 (Lewis blood group)
• Alternate names: galactoside 3(4)-L-fucosyltransferase, Lewis FT, alpha-(1,3/1,4)-fucosyltransferase, blood group Lewis alpha-4-fucosyltransferase, fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group), fucosyltransferase III,
• Gene location: 19p13.3 (5851448: 5842887)     Exons: 5     NC_000019.10
• Gene summary(Entrez): The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis
• OMIM: 605187

Protein Summary

• Protein general information: P21217  
  • Name: Galactoside 3(4) L fucosyltransferase (EC 2.4.1.65) (Blood group Lewis alpha 4 fucosyltransferase) (Lewis FT) (Fucosyltransferase 3) (Fucosyltransferase III) (FucT III)
  • Length: 361  
  • Mass: 42117
  • Tissue specificity: Highly expressed in stomach, colon, small intestine, lung and kidney and to a lesser extent in salivary gland, bladder, uterus and liver.
• Sequence:

  MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIP
  VALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALD
  RYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRS
  HKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPK
  DLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT

• Structural information:
  • Interpro: IPR031481  IPR001503  IPR038577  
  • STRING: ENSP00000305603
• Other Databases: GeneCards:  FUT3  Malacards:  FUT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IBA	molecular function
GO:0036065	fucosylation	IBA	biological process
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0009311	oligosaccharide metabolic process	IDA	biological process
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0036065	fucosylation	IDA	biological process
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IMP	molecular function
GO:0030334	regulation of cell migration	IMP	biological process
GO:0042127	regulation of cell population proliferation	IMP	biological process
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IMP	molecular function
GO:0022409	positive regulation of cell-cell adhesion	IMP	biological process
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IMP	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IMP	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008417	fucosyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008417	fucosyltransferase activity	IDA	molecular function
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IDA	molecular function
GO:0008417	fucosyltransferase activity	IDA	molecular function
GO:0009988	cell-cell recognition	IC	biological process
GO:0043413	macromolecule glycosylation	IDA	biological process
GO:0043413	macromolecule glycosylation	IDA	biological process
GO:0009312	oligosaccharide biosynthetic process	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00601	Glycosphingolipid biosynthesis - lacto and neolacto series

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq