• Gene id: 2524

Gene Summary

• Gene Symbol: FUT2   Gene   UCSC   Ensembl
• Aliases: B12QTL1, SE, SEC2, Se2, sej
• Gene name: fucosyltransferase 2
• Alternate names: galactoside 2-alpha-L-fucosyltransferase 2, GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2, alpha (1,2) fucosyltransferase, alpha(1,2)FT 2, alpha(1,2)FT2, fucosyltransferase 2 (secretor status included), galactoside 2-L-fucosyltransferase, secret,
• Gene location: 19q13.33 (48695970: 48705950)     Exons: 2     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding th

Protein Summary

• Protein general information: Q10981  
  • Name: Galactoside 2 alpha L fucosyltransferase 2 (EC 2.4.1.344) (EC 2.4.1.69) (Alpha(1,2)FT 2) (Fucosyltransferase 2) (GDP L fucose:beta D galactoside 2 alpha L fucosyltransferase 2) (SE2) (Secretor blood group alpha 2 fucosyltransferase) (Secretor factor) (Se)
  • Length: 343  
  • Mass: 39017
  • Tissue specificity: Small intestine, colon and lung.
• Sequence:

  MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQ
  MGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGY
  PCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQ
  ALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTG
  GDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH

• Structural information:
  • Interpro: IPR002516  
  • STRING: ENSP00000387498
• Other Databases: GeneCards:  FUT2  Malacards:  FUT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008107	galactoside 2-alpha-L-fucosyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IBA	biological process
GO:0036065	fucosylation	IBA	biological process
GO:0031127	alpha-(1,2)-fucosyltransferase activity	ISS	molecular function
GO:0030155	regulation of cell adhesion	ISS	biological process
GO:0001936	regulation of endothelial cell proliferation	ISS	biological process
GO:0006664	glycolipid metabolic process	ISS	biological process
GO:0031127	alpha-(1,2)-fucosyltransferase activity	ISS	molecular function
GO:0031127	alpha-(1,2)-fucosyltransferase activity	ISS	molecular function
GO:0036065	fucosylation	ISS	biological process
GO:0036065	fucosylation	ISS	biological process
GO:0036065	fucosylation	ISS	biological process
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008107	galactoside 2-alpha-L-fucosyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0008417	fucosyltransferase activity	TAS	molecular function
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0008107	galactoside 2-alpha-L-fucosyltransferase activity	IEA	molecular function
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0008107	galactoside 2-alpha-L-fucosyltransferase activity	TAS	molecular function
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042355	L-fucose catabolic process	NAS	biological process
GO:0006486	protein glycosylation	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00601	Glycosphingolipid biosynthesis - lacto and neolacto series
hsa00603	Glycosphingolipid biosynthesis - globo and isoglobo series

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq