• Gene id: 250

Gene Summary

• Gene Symbol: ALPP   Gene   UCSC   Ensembl
• Aliases: ALP, ALPI, IAP, PALP, PLAP, PLAP-1
• Gene name: alkaline phosphatase, placental
• Alternate names: alkaline phosphatase, placental type, Intestinal alkaline phosphatase, Intestinal-type alkaline phosphatase, alkaline phosphatase Regan isozyme, alkaline phosphomonoesterase, glycerophosphatase, placental alkaline phosphatase 1,
• Gene location: 2q37.1 (232378750: 232382888)     Exons: 11     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodime
• OMIM: 171800

Protein Summary

• Protein general information: P05187  
  • Name: Alkaline phosphatase, placental type (EC 3.1.3.1) (Alkaline phosphatase Regan isozyme) (Placental alkaline phosphatase 1) (PLAP 1)
  • Length: 535  
  • Mass: 57954
  • Tissue specificity: Detected in placenta (at protein level). {ECO
• Sequence:

  MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAAR
  ILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNE
  VISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGG
  RKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI
  HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSL
  VTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLD
  EETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGT
  LLLLETATAP

• Structural information:
  • Interpro: IPR001952  IPR018299  IPR017850  
  • Prosite: PS00123
  • CDD: cd16012
  • PDB: 1EW2 1ZEB 1ZED 1ZEF 2GLQ 3MK0 3MK1 3MK2
  • PDBsum: 1EW2 1ZEB 1ZED 1ZEF 2GLQ 3MK0 3MK1 3MK2
  • STRING: ENSP00000375881
• Other Databases: GeneCards:  ALPP  Malacards:  ALPP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0004035	alkaline phosphatase activity	IBA	molecular function
GO:0016311	dephosphorylation	IBA	biological process
GO:0008270	zinc ion binding	ISS	molecular function
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004035	alkaline phosphatase activity	IEA	molecular function
GO:0004035	alkaline phosphatase activity	IDA	molecular function
GO:0004035	alkaline phosphatase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0004035	alkaline phosphatase activity	IDA	molecular function
GO:0004035	alkaline phosphatase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00790	Folate biosynthesis
hsa00730	Thiamine metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)