• Gene id: 2475

Gene Summary

• Gene Symbol: MTOR   Gene   UCSC   Ensembl
• Aliases: FRAP, FRAP1, FRAP2, RAFT1, RAPT1, SKS
• Gene name: mechanistic target of rapamycin kinase
• Alternate names: serine/threonine-protein kinase mTOR, FK506 binding protein 12-rapamycin associated protein 2, FK506-binding protein 12-rapamycin complex-associated protein 1, FKBP-rapamycin associated protein, FKBP12-rapamycin complex-associated protein 1, mammalian tar,
• Gene location: 1p36.22 (11273496: 11106530)     Exons: 60     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arres
• OMIM: 601231

Protein Summary

• Protein general information: P42345  
  • Name: Serine/threonine protein kinase mTOR (EC 2.7.11.1) (FK506 binding protein 12 rapamycin complex associated protein 1) (FKBP12 rapamycin complex associated protein) (Mammalian target of rapamycin) (mTOR) (Mechanistic target of rapamycin) (Rapamycin and FKBP
  • Length: 2549  
  • Mass: 288,892
• Sequence:

  MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEESTRFYDQLNHHIFELV
  SSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAGDTFTAEYVEFEVK
  RALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREP
  KEMQKPQWYRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
  KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESRCCRDLMEEKFDQVCQ
  WVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSVAVRSEFKV
  YLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLS
  RQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
  QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCV
  LASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIK
  EQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIM
  DMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
  VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAI
  TFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQS
  TIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAP
  EAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
  RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRV
  SKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDI
  AEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQ
  PEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
  WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAEL
  TAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDM
  RTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQ
  QQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
  VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSK
  TLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPR
  PLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHE
  MWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
  WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLM
  GSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALI
  RDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLA
  VMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
  HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTV
  PESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW

• Structural information:
  • Protein Domains: FAT. (1382-1982)
    PI3K/PI4K. (2182-2516)
    FATC. (2517-2549)
  • Interpro: IPR011989  IPR016024  IPR024585  IPR003152  IPR009076   IPR036738  IPR011009  IPR000403  IPR036940  IPR018936  IPR003151  IPR014009  IPR026683  IPR011990  
  • Prosite: PS51189 PS51190 PS00915 PS00916 PS50290
  • PDB: 1AUE 1FAP 1NSG 2FAP 2GAQ 2NPU 2RSE 3FAP 3JBZ 4DRH 4DRI 4DRJ 4FAP 4JSN 4JSP 4JSV 4JSX 4JT5 4JT6 5FLC 5GPG 5H64 5WBH 5WBU 5WBY 6BCU 6BCX
  • PDBsum: 1AUE 1FAP 1NSG 2FAP 2GAQ 2NPU 2RSE 3FAP 3JBZ 4DRH 4DRI 4DRJ 4FAP 4JSN 4JSP 4JSV 4JSX 4JT5 4JT6 5FLC 5GPG 5H64 5WBH 5WBU 5WBY 6BCU 6BCX
  • DIP: 790
  • STRING: ENSP00000354558
• Other Databases: GeneCards:  MTOR  Malacards:  MTOR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IEA	cellular component
GO:0001030	RNA polymerase III type 1 promoter DNA binding	IDA	molecular function
GO:0001031	RNA polymerase III type 2 promoter DNA binding	IDA	molecular function
GO:0001032	RNA polymerase III type 3 promoter DNA binding	IDA	molecular function
GO:0001156	TFIIIC-class transcription factor binding	IDA	molecular function
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IEA	biological process
GO:0003007	heart morphogenesis	IEA	biological process
GO:0003179	heart valve morphogenesis	IEA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005942	phosphatidylinositol 3-kinase complex	NAS	cellular component
GO:0005979	regulation of glycogen biosynthetic process	IEA	biological process
GO:0006112	energy reserve metabolic process	IEA	biological process
GO:0006207	'de novo' pyrimidine nucleobase biosynthetic process	IEA	biological process
GO:0006281	DNA repair	IBA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IMP	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006950	response to stress	IMP	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0007281	germ cell development	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007569	cell aging	IEA	biological process
GO:0007584	response to nutrient	NAS	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0010507	negative regulation of autophagy	ISS	biological process
GO:0010592	positive regulation of lamellipodium assembly	IEA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010831	positive regulation of myotube differentiation	IEA	biological process
GO:0012505	endomembrane system	IDA	cellular component
GO:0014042	positive regulation of neuron maturation	IEA	biological process
GO:0014736	negative regulation of muscle atrophy	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016049	cell growth	TAS	biological process
GO:0016049	cell growth	IDA	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0016242	negative regulation of macroautophagy	IEA	biological process
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0021510	spinal cord development	IEA	biological process
GO:0030163	protein catabolic process	TAS	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030838	positive regulation of actin filament polymerization	IEA	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0031529	ruffle organization	IEA	biological process
GO:0031641	regulation of myelination	IEA	biological process
GO:0031669	cellular response to nutrient levels	ISS	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0031931	TORC1 complex	IDA	cellular component
GO:0031931	TORC1 complex	IDA	cellular component
GO:0031931	TORC1 complex	IDA	cellular component
GO:0031931	TORC1 complex	IMP	cellular component
GO:0031932	TORC2 complex	IDA	cellular component
GO:0031932	TORC2 complex	IDA	cellular component
GO:0031998	regulation of fatty acid beta-oxidation	IEA	biological process
GO:0032095	regulation of response to food	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0035176	social behavior	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0040007	growth	NAS	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0043022	ribosome binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0043200	response to amino acid	IDA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0043610	regulation of carbohydrate utilization	IEA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0045670	regulation of osteoclast differentiation	ISS	biological process
GO:0045727	positive regulation of translation	IDA	biological process
GO:0045792	negative regulation of cell size	IEA	biological process
GO:0045859	regulation of protein kinase activity	IEA	biological process
GO:0045945	positive regulation of transcription from RNA polymerase III promoter	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046889	positive regulation of lipid biosynthetic process	IMP	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048255	mRNA stabilization	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0050882	voluntary musculoskeletal movement	IEA	biological process
GO:0051219	phosphoprotein binding	IPI	molecular function
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:0051534	negative regulation of NFAT protein import into nucleus	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0055013	cardiac muscle cell development	IEA	biological process
GO:0060048	cardiac muscle contraction	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0060252	positive regulation of glial cell proliferation	IEA	biological process
GO:0060999	positive regulation of dendritic spine development	IEA	biological process
GO:0061051	positive regulation of cell growth involved in cardiac muscle cell development	IEA	biological process
GO:0071456	cellular response to hypoxia	ISS	biological process
GO:0090335	regulation of brown fat cell differentiation	IEA	biological process
GO:0090559	regulation of membrane permeability	IEA	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:1901838	positive regulation of transcription of nuclear large rRNA transcript from RNA polymerase I promoter	IMP	biological process
GO:1904000	positive regulation of eating behavior	IEA	biological process
GO:1904056	positive regulation of cholangiocyte proliferation	IEA	biological process
GO:1904058	positive regulation of sensory perception of pain	IEA	biological process
GO:1904193	negative regulation of cholangiocyte apoptotic process	IEA	biological process
GO:1904197	positive regulation of granulosa cell proliferation	IEA	biological process
GO:1904206	positive regulation of skeletal muscle hypertrophy	IEA	biological process
GO:1904213	negative regulation of iodide transmembrane transport	IEA	biological process
GO:0016605	PML body	ISS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0001030	RNA polymerase III type 1 promoter DNA binding	IDA	molecular function
GO:0001031	RNA polymerase III type 2 promoter DNA binding	IDA	molecular function
GO:0001032	RNA polymerase III type 3 promoter DNA binding	IDA	molecular function
GO:0001156	TFIIIC-class transcription factor binding	IDA	molecular function
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IEA	biological process
GO:0003007	heart morphogenesis	IEA	biological process
GO:0003179	heart valve morphogenesis	IEA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005942	phosphatidylinositol 3-kinase complex	NAS	cellular component
GO:0005979	regulation of glycogen biosynthetic process	IEA	biological process
GO:0006109	regulation of carbohydrate metabolic process	IEA	biological process
GO:0006112	energy reserve metabolic process	IEA	biological process
GO:0006207	'de novo' pyrimidine nucleobase biosynthetic process	IEA	biological process
GO:0006281	DNA repair	IBA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IMP	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006950	response to stress	IMP	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0007281	germ cell development	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007569	cell aging	IEA	biological process
GO:0007584	response to nutrient	NAS	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0010507	negative regulation of autophagy	IEA	biological process
GO:0010507	negative regulation of autophagy	ISS	biological process
GO:0010592	positive regulation of lamellipodium assembly	IEA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010831	positive regulation of myotube differentiation	IEA	biological process
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0012505	endomembrane system	IDA	cellular component
GO:0014042	positive regulation of neuron maturation	IEA	biological process
GO:0014736	negative regulation of muscle atrophy	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016049	cell growth	TAS	biological process
GO:0016049	cell growth	IDA	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0016242	negative regulation of macroautophagy	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016310	phosphorylation	IDA	biological process
GO:0016605	PML body	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0021510	spinal cord development	IEA	biological process
GO:0030030	cell projection organization	IEA	biological process
GO:0030163	protein catabolic process	TAS	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030838	positive regulation of actin filament polymerization	IEA	biological process
GO:0031090	organelle membrane	IEA	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0031529	ruffle organization	IEA	biological process
GO:0031641	regulation of myelination	IEA	biological process
GO:0031669	cellular response to nutrient levels	IEA	biological process
GO:0031669	cellular response to nutrient levels	ISS	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0031931	TORC1 complex	IEA	cellular component
GO:0031931	TORC1 complex	IDA	cellular component
GO:0031931	TORC1 complex	IDA	cellular component
GO:0031931	TORC1 complex	IDA	cellular component
GO:0031931	TORC1 complex	IMP	cellular component
GO:0031932	TORC2 complex	IDA	cellular component
GO:0031932	TORC2 complex	IDA	cellular component
GO:0031998	regulation of fatty acid beta-oxidation	IEA	biological process
GO:0032095	regulation of response to food	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0032991	macromolecular complex	IEA	cellular component
GO:0035176	social behavior	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0040007	growth	NAS	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0043022	ribosome binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043200	response to amino acid	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043278	response to morphine	IEA	biological process
GO:0043610	regulation of carbohydrate utilization	IEA	biological process
GO:0044877	macromolecular complex binding	IEA	molecular function
GO:0045429	positive regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0045670	regulation of osteoclast differentiation	IEA	biological process
GO:0045670	regulation of osteoclast differentiation	ISS	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0045727	positive regulation of translation	IDA	biological process
GO:0045792	negative regulation of cell size	IEA	biological process
GO:0045859	regulation of protein kinase activity	IEA	biological process
GO:0045945	positive regulation of transcription from RNA polymerase III promoter	IMP	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046889	positive regulation of lipid biosynthetic process	IMP	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048255	mRNA stabilization	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	IEA	biological process
GO:0048738	cardiac muscle tissue development	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0050769	positive regulation of neurogenesis	IEA	biological process
GO:0050882	voluntary musculoskeletal movement	IEA	biological process
GO:0051219	phosphoprotein binding	IPI	molecular function
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:0051534	negative regulation of NFAT protein import into nucleus	IEA	biological process
GO:0051896	regulation of protein kinase B signaling	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0055006	cardiac cell development	IEA	biological process
GO:0055013	cardiac muscle cell development	IEA	biological process
GO:0060048	cardiac muscle contraction	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0060252	positive regulation of glial cell proliferation	IEA	biological process
GO:0060999	positive regulation of dendritic spine development	IEA	biological process
GO:0061051	positive regulation of cell growth involved in cardiac muscle cell development	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071456	cellular response to hypoxia	ISS	biological process
GO:0090335	regulation of brown fat cell differentiation	IEA	biological process
GO:0090559	regulation of membrane permeability	IEA	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:1901838	positive regulation of transcription of nuclear large rRNA transcript from RNA polymerase I promoter	IMP	biological process
GO:1904000	positive regulation of eating behavior	IEA	biological process
GO:1904056	positive regulation of cholangiocyte proliferation	IEA	biological process
GO:1904058	positive regulation of sensory perception of pain	IEA	biological process
GO:1904193	negative regulation of cholangiocyte apoptotic process	IEA	biological process
GO:1904197	positive regulation of granulosa cell proliferation	IEA	biological process
GO:1904206	positive regulation of skeletal muscle hypertrophy	IEA	biological process
GO:1904213	negative regulation of iodide transmembrane transport	IEA	biological process
GO:0016605	PML body	ISS	cellular component
GO:0001030	RNA polymerase III type 1 promoter DNA binding	IDA	molecular function
GO:0001031	RNA polymerase III type 2 promoter DNA binding	IDA	molecular function
GO:0001032	RNA polymerase III type 3 promoter DNA binding	IDA	molecular function
GO:0001156	TFIIIC-class transcription factor binding	IDA	molecular function
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005942	phosphatidylinositol 3-kinase complex	NAS	cellular component
GO:0006281	DNA repair	IBA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IMP	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006950	response to stress	IMP	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0007584	response to nutrient	NAS	biological process
GO:0010507	negative regulation of autophagy	ISS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0012505	endomembrane system	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016049	cell growth	TAS	biological process
GO:0016049	cell growth	IDA	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0030163	protein catabolic process	TAS	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0031669	cellular response to nutrient levels	ISS	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0031931	TORC1 complex	IDA	cellular component
GO:0031931	TORC1 complex	IDA	cellular component
GO:0031931	TORC1 complex	IDA	cellular component
GO:0031931	TORC1 complex	IMP	cellular component
GO:0031932	TORC2 complex	IDA	cellular component
GO:0031932	TORC2 complex	IDA	cellular component
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0040007	growth	NAS	biological process
GO:0043200	response to amino acid	IDA	biological process
GO:0045670	regulation of osteoclast differentiation	ISS	biological process
GO:0045727	positive regulation of translation	IDA	biological process
GO:0045945	positive regulation of transcription from RNA polymerase III promoter	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046889	positive regulation of lipid biosynthetic process	IMP	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0051219	phosphoprotein binding	IPI	molecular function
GO:0071456	cellular response to hypoxia	ISS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1901838	positive regulation of transcription of nuclear large rRNA transcript from RNA polymerase I promoter	IMP	biological process
GO:0016605	PML body	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04066	HIF-1 signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04152	AMPK signaling pathway
hsa04150	mTOR signaling pathway
hsa04140	Autophagy - animal
hsa04136	Autophagy - other
hsa04218	Cellular senescence
hsa04659	Th17 cell differentiation
hsa04910	Insulin signaling pathway
hsa04920	Adipocytokine signaling pathway
hsa04919	Thyroid hormone signaling pathway
hsa04211	Longevity regulating pathway
hsa04213	Longevity regulating pathway - multiple species
hsa04714	Thermogenesis
hsa05200	Pathways in cancer
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer
hsa05230	Central carbon metabolism in cancer
hsa05231	Choline metabolism in cancer
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa05214	Glioma
hsa05221	Acute myeloid leukemia
hsa05215	Prostate cancer
hsa05224	Breast cancer
hsa04930	Type II diabetes mellitus
hsa04931	Insulin resistance
hsa05170	Human immunodeficiency virus 1 infection
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05165	Human papillomavirus infection
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Cancer (colon)	GAD: 21035469
Cancer (esophageal)	GAD: 20453000
Cancer (lung)	GAD: 20447721
Cancer (esophageal)	GAD: 19164214
Cancer	GAD: 19164214
Corneal diseases	GAD: 21665993
Corneal diseases	GAD: 21665993
Alzheimer's disease	GAD: 19141999
Chronic renal failure	GAD: 21085059
Endometriosis	INFBASE: 25721338
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Focal cortical dysplasia	OMIM: 601231
Smith-Kingsmore syndrome	OMIM: 601231
Non-obstructive azoospermia (NOA)	MIK: 19210773
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26209830	Semen quality, Sperm motility			37 men provided semen samples for routine analysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR p38 MAPK p53PARP Caspase-3 Akt Stat1 and p70 S6 kinase
26209830	Sperm motility			37 men provided semen samples for routine analysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR  p38 MAPK p53 PARP Caspase-3
19210773	Non-obstructive azoospermia (NOA)				Male infertility	miR-302a miR-491-3p miR-520d-3p and miR-383
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R