About Us

Search Result


Gene id 247
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ALOX15B   Gene   UCSC   Ensembl
Aliases 15-LOX-2
Gene name arachidonate 15-lipoxygenase type B
Alternate names arachidonate 15-lipoxygenase B, 15-LOX-B, 15S-lipoxygenase, arachidonate 15-lipoxygenase 2, arachidonate 15-lipoxygenase type II, arachidonate 15-lipoxygenase, second type, arachidonate omega(6) lipoxygenase, linoleate 13-lipoxygenase 15-LOb,
Gene location 17p13.1 (8039039: 8049133)     Exons: 14     NC_000017.11
Gene summary(Entrez) This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic a
OMIM 600744

Protein Summary

Protein general information O15296  

Name: Arachidonate 15 lipoxygenase B (15 LOX B) (EC 1.13.11.33) (15 lipoxygenase 2) (15 LOX 2) (Arachidonate 15 lipoxygenase type II) (Linoleate 13 lipoxygenase 15 LOb) (EC 1.13.11. )

Length: 676  Mass: 75857

Tissue specificity: Expressed in hair, prostate, lung, ovary, lymph node, spinal cord and cornea. {ECO

Sequence MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPV
LPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQ
WKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAA
EHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWVRNAEFSFHEALTHLL
HSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGFSELIQRNMKQLN
YSLLCLPEDIRTRGVEDIPGYYYRDDGMQIWGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQES
SGIPSSLETREALVQYVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVLPYTYLDPPLIENSVS
I
Structural information
Protein Domains
(2..12-)
(/note="PLAT-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00152-)
(125..67-)
(/note="Lipoxygenase-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00726"-)
Interpro:  IPR000907  IPR013819  IPR036226  IPR020834  IPR020833  
IPR001885  IPR001024  IPR036392  IPR042062  
Prosite:   PS00711 PS00081 PS51393 PS50095
CDD:   cd01753

PDB:  
4NRE
PDBsum:   4NRE
STRING:   ENSP00000369530
Other Databases GeneCards:  ALOX15B  Malacards:  ALOX15B

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0050473 arachidonate 15-lipoxygen
ase activity
IBA molecular function
GO:0043651 linoleic acid metabolic p
rocess
IBA biological process
GO:0019372 lipoxygenase pathway
IBA biological process
GO:0016702 oxidoreductase activity,
acting on single donors w
ith incorporation of mole
cular oxygen, incorporati
on of two atoms of oxygen
IBA molecular function
GO:0051122 hepoxilin biosynthetic pr
ocess
IBA biological process
GO:0034440 lipid oxidation
IBA biological process
GO:0019369 arachidonic acid metaboli
c process
IBA biological process
GO:0006644 phospholipid metabolic pr
ocess
IDA biological process
GO:0050473 arachidonate 15-lipoxygen
ase activity
IDA molecular function
GO:0050473 arachidonate 15-lipoxygen
ase activity
IDA molecular function
GO:2001303 lipoxin A4 biosynthetic p
rocess
IDA biological process
GO:0050473 arachidonate 15-lipoxygen
ase activity
IDA molecular function
GO:0005912 adherens junction
IDA cellular component
GO:0050473 arachidonate 15-lipoxygen
ase activity
IDA molecular function
GO:0050473 arachidonate 15-lipoxygen
ase activity
IDA molecular function
GO:0050473 arachidonate 15-lipoxygen
ase activity
IDA molecular function
GO:0050473 arachidonate 15-lipoxygen
ase activity
IDA molecular function
GO:0050473 arachidonate 15-lipoxygen
ase activity
IDA molecular function
GO:0050473 arachidonate 15-lipoxygen
ase activity
IDA molecular function
GO:0019898 extrinsic component of me
mbrane
IDA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0005509 calcium ion binding
IDA molecular function
GO:0005506 iron ion binding
IDA molecular function
GO:0005886 plasma membrane
IDA cellular component
GO:0006629 lipid metabolic process
IDA biological process
GO:0006629 lipid metabolic process
IDA biological process
GO:0019369 arachidonic acid metaboli
c process
IDA biological process
GO:0005925 focal adhesion
IDA cellular component
GO:0071926 endocannabinoid signaling
pathway
IDA biological process
GO:1901696 cannabinoid biosynthetic
process
IDA biological process
GO:0019369 arachidonic acid metaboli
c process
IDA biological process
GO:0019369 arachidonic acid metaboli
c process
IDA biological process
GO:0019369 arachidonic acid metaboli
c process
IDA biological process
GO:0019369 arachidonic acid metaboli
c process
IDA biological process
GO:0016165 linoleate 13S-lipoxygenas
e activity
IDA molecular function
GO:0016020 membrane
IDA cellular component
GO:0005886 plasma membrane
IDA cellular component
GO:0005856 cytoskeleton
IDA cellular component
GO:0090197 positive regulation of ch
emokine secretion
IMP biological process
GO:0010744 positive regulation of ma
crophage derived foam cel
l differentiation
IMP biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
IMP biological process
GO:0051122 hepoxilin biosynthetic pr
ocess
ISS biological process
GO:0005506 iron ion binding
IEA molecular function
GO:0016702 oxidoreductase activity,
acting on single donors w
ith incorporation of mole
cular oxygen, incorporati
on of two atoms of oxygen
IEA molecular function
GO:0046872 metal ion binding
IEA molecular function
GO:0055114 oxidation-reduction proce
ss
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0008289 lipid binding
IEA molecular function
GO:0055114 oxidation-reduction proce
ss
IEA biological process
GO:0030054 cell junction
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0016491 oxidoreductase activity
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0006629 lipid metabolic process
IEA biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0051213 dioxygenase activity
IEA molecular function
GO:0016020 membrane
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0050473 arachidonate 15-lipoxygen
ase activity
IEA molecular function
GO:0005829 cytosol
TAS cellular component
GO:0019372 lipoxygenase pathway
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0045618 positive regulation of ke
ratinocyte differentiatio
n
IEA biological process
GO:0043651 linoleic acid metabolic p
rocess
IEA biological process
GO:0036403 arachidonate 8(S)-lipoxyg
enase activity
IEA molecular function
GO:0019372 lipoxygenase pathway
IEA biological process
GO:0035360 positive regulation of pe
roxisome proliferator act
ivated receptor signaling
pathway
IEA biological process
GO:0019369 arachidonic acid metaboli
c process
IEA biological process
GO:0005912 adherens junction
IEA cellular component
GO:0005829 cytosol
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005925 focal adhesion
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005886 plasma membrane
IDA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0050473 arachidonate 15-lipoxygen
ase activity
IDA molecular function
GO:0008285 negative regulation of ce
ll population proliferati
on
IDA biological process
GO:0045786 negative regulation of ce
ll cycle
IDA biological process
GO:0019369 arachidonic acid metaboli
c process
IDA biological process
GO:0045926 negative regulation of gr
owth
IDA biological process
GO:0006915 apoptotic process
TAS biological process
GO:0006629 lipid metabolic process
TAS biological process
GO:0070062 extracellular exosome
HDA cellular component
GO:0030850 prostate gland developmen
t
NAS biological process
GO:0030856 regulation of epithelial
cell differentiation
NAS biological process
GO:0030336 negative regulation of ce
ll migration
TAS biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa01100Metabolic pathways
hsa04726Serotonergic synapse
hsa00590Arachidonic acid metabolism
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract