• Gene id: 246184

Gene Summary

• Gene Symbol: CDC26   Gene   UCSC   Ensembl
• Aliases: ANAPC12, APC12, C9orf17
• Gene name: cell division cycle 26
• Alternate names: anaphase-promoting complex subunit CDC26, CDC26 subunit of anaphase promoting complex, anaphase-promoting complex subunit 12, cell division cycle 26 homolog, cell division cycle protein 26 homolog,
• Gene location: 9q32 (113275578: 113266991)     Exons: 5     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-pro
• OMIM: 613226

Protein Summary

• Protein general information: Q8NHZ8  
  • Name: Anaphase promoting complex subunit CDC26 (Anaphase promoting complex subunit 12) (APC12) (Cell division cycle protein 26 homolog)
  • Length: 85  
  • Mass: 9777
• Sequence:

  MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNN
  RSSQFGSLEF

• Structural information:
  • Interpro: IPR018860  
  • PDB: 3HYM 4UI9 5A31 5G04 5G05 5KHR 5KHU 5L9T 5L9U 5LCW 6Q6G 6Q6H
  • PDBsum: 3HYM 4UI9 5A31 5G04 5G05 5KHR 5KHU 5L9T 5L9U 5LCW 6Q6G 6Q6H
  • DIP: 48551
  • STRING: ENSP00000363322
• Other Databases: GeneCards:  CDC26  Malacards:  CDC26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070979	protein K11-linked ubiquitination	IBA	biological process
GO:0005680	anaphase-promoting complex	IBA	cellular component
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0005680	anaphase-promoting complex	IDA	cellular component
GO:0005680	anaphase-promoting complex	IEA	cellular component
GO:0030071	regulation of mitotic metaphase/anaphase transition	IEA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005680	anaphase-promoting complex	IDA	cellular component
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:1901990	regulation of mitotic cell cycle phase transition	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa04120	Ubiquitin mediated proteolysis
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881