• Gene id: 246181

Gene Summary

• Gene Symbol: AKR7L   Gene   UCSC   Ensembl
• Aliases: AFAR3, AFB1-AR 3, AFB1-AR3, AKR7A4
• Gene name: aldo-keto reductase family 7 like (gene/pseudogene)
• Alternate names: aflatoxin B1 aldehyde reductase member 4, AFB1 aldehyde reductase 3, aldo-keto reductase family 7 pseudogene, aldo-keto reductase family 7-like, aldoketoreductase 7-like,
• Gene location: 1p35-p36.1 (19274121: 19265981)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene is one of three aldo-keto reductase genes that are present in a cluster on the p arm of chromosome 1. The encoded proteins are involved in the reduction of the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialco
• OMIM: 600912

Protein Summary

• Protein general information: Q8NHP1  
  • Name: Aflatoxin B1 aldehyde reductase member 4 (EC 1. . . ) (AFB1 aldehyde reductase 3) (AFB1 AR 3) (Aldoketoreductase 7 like)
  • Length: 331  
  • Mass: 36970
  • Tissue specificity: Mainly expressed in uterus. {ECO
• Sequence:

  MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFLYSDGQSETILGGLGLRMGSSDCRVKIA
  TKANPWIGNSLKPDSVRSQLETSLKRLQCPRVDLFYLHAPDHSAPVEETLRACHQLHQEGKFVELGLSNYAAWEV
  AEICTLCKSNGWILPTVYQGMYSATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFG
  TQWAEIYRNHFWKEHHFEGIALVEKALQAAYGASAPSMTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLA
  AAEEGPLEPAVVDAFNQAWHLFAHECPNYFI

• Structural information:
  • Interpro: IPR023210  IPR036812  
  • CDD: cd06660
• Other Databases: GeneCards:  AKR7L  Malacards:  AKR7L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq